DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlE and TwdlD

DIOPT Version :9

Sequence 1:NP_609157.3 Gene:TwdlE / 34075 FlyBaseID:FBgn0031957 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_651492.1 Gene:TwdlD / 43210 FlyBaseID:FBgn0039444 Length:256 Species:Drosophila melanogaster


Alignment Length:171 Identity:40/171 - (23%)
Similarity:67/171 - (39%) Gaps:39/171 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 PQQAPVI---HKHVYVHVPPPEPEYQAPRKPLYVPPPQKHYKIVFIKAPSPPVPTAPVIPQFPQN 116
            ||.||::   .|..|.:..|.|...:...........:|:.::|||:.|.........:....|:
  Fly    70 PQIAPLVEEFQKEFYSYAAPEEQYDEGASNQQIANSLKKNLRVVFIRTPENQGFERAALQLAKQS 134

  Fly   117 -EEKTLVYVLVKKPE-----EQPEIIIPTPAPTQPSKPEVYFIRYKT------------------ 157
             :::|.:|||.|:.:     :|...:    ..:..:||||:|::|:|                  
  Fly   135 AQQETAIYVLTKQSDVSNLAKQLNAL----KTSSTNKPEVHFVKYRTPEDAANAQLAIQNQYNQL 195

  Fly   158 ------QKEETGPYPNSVAPPAPEYGAPAAPPAPSAPSSSY 192
                  ..|...|..|..:.||.....||.  |.:||||.|
  Fly   196 PGVSRISNEGRAPVLNFASSPAQAAAIPAV--AAAAPSSEY 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlENP_609157.3 DM5 59..158 CDD:214776 24/131 (18%)
TwdlDNP_651492.1 DM5 78..178 CDD:214776 22/103 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450422
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.