DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlE and TwdlO

DIOPT Version :9

Sequence 1:NP_609157.3 Gene:TwdlE / 34075 FlyBaseID:FBgn0031957 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_651487.1 Gene:TwdlO / 43204 FlyBaseID:FBgn0039438 Length:229 Species:Drosophila melanogaster


Alignment Length:191 Identity:47/191 - (24%)
Similarity:74/191 - (38%) Gaps:35/191 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PSSSYQPSGPSGGYGAPAPQYGPPQQAPVIHKHVYVHVPPPEPEYQAPRKPLYVP-PPQKHYKIV 95
            ||.|....|.|....|.:|.|....:   ::|..|. ....|.:::.|.....:. ...|..::|
  Fly    32 PSYSGSSVGDSYDGAASSPDYSVSSE---LNKEYYT-FEADESQFEDPLAAQKIAGSVNKGLRVV 92

  Fly    96 FIKAP-SPPVPTAPVIPQFPQNEEKTLVYVLVKKPEEQPEIIIPTPAPTQPS--KPEVYFIRYKT 157
            |||.| :..:..|.:.......|::|.:||| .|..:..::.....|..|.|  :|||:|::|:|
  Fly    93 FIKGPENRGLENAALALAKQAAEQRTAIYVL-NKQTDIGDLAQKFNAARQNSNQRPEVHFVKYRT 156

  Fly   158 -------QKEETGPYPN-------------------SVAPPAPEYGAPAAPPAPSAPSSSY 192
                   |:.....|.|                   |.||..|....|...|..:|.|:||
  Fly   157 PEDAANAQRAIQSQYDNLGGSSQSINGGVANAINFASAAPVVPARRGPNYSPPAAATSNSY 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlENP_609157.3 DM5 59..158 CDD:214776 26/109 (24%)
TwdlONP_651487.1 DM5 56..157 CDD:214776 25/105 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450419
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.