DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlE and TwdlP

DIOPT Version :9

Sequence 1:NP_609157.3 Gene:TwdlE / 34075 FlyBaseID:FBgn0031957 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_651485.1 Gene:TwdlP / 43201 FlyBaseID:FBgn0039435 Length:220 Species:Drosophila melanogaster


Alignment Length:220 Identity:54/220 - (24%)
Similarity:85/220 - (38%) Gaps:48/220 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LVVLMALAALVAARPEPPRDSYSAPPSSSY---QPSGPS-GGYG-APAP------QYGPPQQAPV 60
            |::|..:||.            ||...|.|   |.:..| ||.| :|.|      .|....||.|
  Fly     4 LIILSIVAAA------------SAGSLSGYNYGQGATTSIGGSGVSPVPALAGPVSYSAAPQASV 56

  Fly    61 IHKHVYVHVPPPEPEYQAPRKPLYVPPPQKHYKIVFIKAPSPPVPTAPVIPQFPQ-NEEKTLVYV 124
             ||..|......:...........:...:|:.:::|||:|........|:....| .:::|.:||
  Fly    57 -HKEFYSFYANDDDFEDKAALQRALASVKKNIRVIFIKSPENRGYENAVLALAKQAAQQQTAIYV 120

  Fly   125 LVKKPEEQPEIIIPTPAPTQPS--KPEVYFIRYKT-------------QKEETGPYPNSVAPP-- 172
            |.|:.:.. |:.....|..|.:  ||||:|::|:|             |.::.|....|:...  
  Fly   121 LHKQTDIN-ELAQKFNAVRQNANKKPEVHFVKYRTPEDAANAQRAIQSQYDQLGGSSQSINGGVA 184

  Fly   173 -----APEYGAPAAPPAPSAPSSSY 192
                 |.:..|||.......|.|:|
  Fly   185 NAINFASQGAAPARVTPQQVPQSNY 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlENP_609157.3 DM5 59..158 CDD:214776 26/114 (23%)
TwdlPNP_651485.1 DUF243 57..152 CDD:281144 23/95 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450420
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.