DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlE and TwdlV

DIOPT Version :9

Sequence 1:NP_609157.3 Gene:TwdlE / 34075 FlyBaseID:FBgn0031957 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_649446.1 Gene:TwdlV / 40537 FlyBaseID:FBgn0037227 Length:251 Species:Drosophila melanogaster


Alignment Length:169 Identity:55/169 - (32%)
Similarity:76/169 - (44%) Gaps:45/169 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 SAPPSSSYQPSGPSGGYG-----------------APA-PQ--YGPP-------------QQAPV 60
            :||...:|.| ||||..|                 ||. ||  |..|             ||..:
  Fly    15 AAPQGYNYNP-GPSGFGGISTTTGGGSFFQGAVQVAPVQPQAVYQQPAAQTHHHQQQQVQQQQAI 78

  Fly    61 IHKHVYVHVPPPEPEYQAPRKPLYVPPPQKHYKIVFIKAPS----PPVPTAPVIPQFPQNEEKTL 121
            :.|..::|..|.|.|....|. :.|..|:::|.:||||:|.    ..:..:|.     .|||||:
  Fly    79 VSKRFFIHSAPEEAEDYKERH-ITVGVPKRNYNVVFIKSPQRNNRKTIKISPA-----ANEEKTV 137

  Fly   122 VYVLVKKPEEQPEIIIPTPAPTQPSKPEVYFIRYKTQKE 160
            :|||.||.|......:...| :..|||||:||:|||.:|
  Fly   138 IYVLSKKGESDLNAEVVEQA-SSTSKPEVFFIKYKTNEE 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlENP_609157.3 DM5 59..158 CDD:214776 36/102 (35%)
TwdlVNP_649446.1 DM5 78..173 CDD:214776 36/101 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450407
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.