DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlE and Twdlalpha

DIOPT Version :9

Sequence 1:NP_609157.3 Gene:TwdlE / 34075 FlyBaseID:FBgn0031957 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_728020.1 Gene:Twdlalpha / 326223 FlyBaseID:FBgn0052574 Length:388 Species:Drosophila melanogaster


Alignment Length:218 Identity:76/218 - (34%)
Similarity:98/218 - (44%) Gaps:47/218 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SYSAPPSSSYQPSG-------PSGGYGA----PAPQYGPPQ--------QAPVIHKHVYVHVPPP 72
            :||...||:|..|.       |:.|:||    .||.|...|        |.|:|||..:....|.
  Fly   120 TYSTGGSSNYGGSSFTGFGPTPNIGFGALAGYQAPTYQQQQEQEVQRGFQEPIIHKQFFTVAAPE 184

  Fly    73 EPEYQAPRKPLYVPPPQKHYKIVFIKAPSPPVPTAPVIPQFPQNEEKTLVYVLVKKPEEQPEIII 137
            |.|.....|.|.:..|||:|::|||||||.......:..::...||||::|||.||..:.....|
  Fly   185 EHENLERSKHLVIGRPQKNYRVVFIKAPSSSNANVKLSAEYAPKEEKTVIYVLSKKDNQLEVNDI 249

  Fly   138 PTPAPTQPSKPEVYFIRYKT-------QKEETGPY----------PNSVAPPAPEYGA--PAAPP 183
            .|||||.||||||:||:|||       |::....|          ...|||.....|.  ..|..
  Fly   250 ATPAPTVPSKPEVFFIKYKTDAEASHAQQQIQAEYDRIEGTSEHQDGGVAPAQSVVGILDGGAIG 314

  Fly   184 APSAPSSSY---------GAPSH 197
            |.|:.||:|         |..||
  Fly   315 AASSGSSNYVSGGTTGSTGGTSH 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlENP_609157.3 DM5 59..158 CDD:214776 46/105 (44%)
TwdlalphaNP_728020.1 DM5 171..270 CDD:214776 45/98 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450403
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.