DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlE and TwdlR

DIOPT Version :9

Sequence 1:NP_609157.3 Gene:TwdlE / 34075 FlyBaseID:FBgn0031957 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_733161.2 Gene:TwdlR / 318586 FlyBaseID:FBgn0051081 Length:325 Species:Drosophila melanogaster


Alignment Length:261 Identity:60/261 - (22%)
Similarity:90/261 - (34%) Gaps:82/261 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHSSCVLVVLMALAALVAARPEPPRDSYSAPPSSSYQPSGPSGGYGAPAPQYGPP---------- 55
            :|...:::.::.|..|..:         ||.....||    ...||.|...||..          
  Fly     5 LHIGYIMLGIVFLTLLAGS---------SAELGYQYQ----QNSYGGPVNSYGNEAVLGDERYHS 56

  Fly    56 ------QQAPVIHKHVYVHVPPPEPEYQAPRKPLYVPP-PQKHYKIVFIKAPSPPVPTAPVIPQF 113
                  |:....|||.|....|.:...:.......:.. .||:.::||||||........:....
  Fly    57 QPGNHYQENADFHKHFYAFEAPYDSVEEVDLAETKLSSLAQKNLQVVFIKAPENKAVVGALNALA 121

  Fly   114 PQ-NEEKTLVYVLVKKPEEQPEIIIPTPA--PTQPSKPEVYFIRYKTQKE--------------- 160
            .| :|:||.:|||.|:.:.. |:.....|  .....||:|:|::|||::|               
  Fly   122 KQTSEDKTAIYVLNKQTDVN-ELASQLSALKAHHKHKPQVHFVKYKTEEEAAQAQQYIQAQYGGG 185

  Fly   161 ----------ETGPYPNSV------AP------------PAPEYGA--PAA---PPAPSAPSSSY 192
                      ..|.||...      ||            |:|:..|  |.:   ||.||..|.|.
  Fly   186 SSIPQPGKASSLGYYPEQQPQYEQDAPSEEYPAGQVGYLPSPQQSAYQPQSGYLPPLPSYSSISQ 250

  Fly   193 G 193
            |
  Fly   251 G 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlENP_609157.3 DM5 59..158 CDD:214776 29/102 (28%)
TwdlRNP_733161.2 DUF243 69..165 CDD:281144 27/96 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450411
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.