DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14535 and sub

DIOPT Version :9

Sequence 1:NP_001285726.1 Gene:CG14535 / 34073 FlyBaseID:FBgn0031955 Length:1131 Species:Drosophila melanogaster
Sequence 2:NP_001286548.1 Gene:sub / 44870 FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster


Alignment Length:376 Identity:73/376 - (19%)
Similarity:128/376 - (34%) Gaps:117/376 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 KMFAFDNLFTGEDKQSDVCASALSEVIPAVLEGSDGCLLAMGYPATGQAQTVLGELGGGSGSGSA 165
            |.|.|.::|.....|.|:..:.:.   |.::|.....::..|...:|:..|:||:          
  Fly   131 KHFGFTSIFDSTVGQRDIYDTCVG---PKIMEEECVTIMTYGTSGSGKTYTLLGD---------- 182

  Fly   166 SGSGVACSLGAAPCAIAWLYKGIQERRQKSGARFSVRVSAVGVSATKPDALSQDLLI-------- 222
                 ....|..|.|:..::...|:...:|.....:..|.|.:   :.||..::|.|        
  Fly   183 -----DVRAGIIPRALENIFTIYQDTVFRSPKLKLINGSIVFL---QDDASLKELQIRKKLLDLC 239

  Fly   223 ----------------SHAAESDDSPGIYL----------------------RDDFLG------- 242
                            .|..|:..|..:.:                      :.|.||       
  Fly   240 PDISAHHQRLKQVIDGDHMFETKASTDVSVLVWVSFVEIYNELVYDLLAIPPKQDKLGEVPRKNL 304

  Fly   243 ------------GPTELRAPTAERAALFLDSALAGRLKSSGSTASGSSGCAAPLESALIFTLHVY 295
                        |.|.:...::|.|...|      ||....||.:.:|..|....|..:||:.:.
  Fly   305 KIVGNKGHVFIKGLTSVFVTSSEEALRLL------RLGQQRSTYASTSVNANSSRSHCVFTVDIL 363

  Fly   296 QYSLSRKGGVAGGRSRLHIIDLGGC--ANRNG--GLPLSG----------IGNILLAILSGQRHP 346
            :|:   :.|:. .:|.....||.|.  .|..|  ||.|..          :|..|.|..:.|:..
  Fly   364 KYN---RSGIT-TQSSYKFCDLAGSERVNNTGTSGLRLKEAKNINTSLMVLGRCLDAASTVQKKK 424

  Fly   347 -----PHKDHPLTPLLKDCLAPITCHVAIVAHVRP-EQSYQDALSTIQIAS 391
                 |::|..||.||:..|.... .:|::..|.| ::.|::.|:.:..||
  Fly   425 NADIIPYRDSKLTMLLQAALLGKE-KLAMIVTVTPLDKYYEENLNVLNFAS 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14535NP_001285726.1 Motor_domain 44..394 CDD:277568 73/376 (19%)
subNP_001286548.1 KISc 89..477 CDD:276812 73/376 (19%)
Kinesin 93..479 CDD:278646 73/376 (19%)
GBP_C <512..603 CDD:303769
coiled coil 576..586 CDD:293879
coiled coil 592..603 CDD:293879
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24115
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.