DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14535 and Kif3C

DIOPT Version :9

Sequence 1:NP_001285726.1 Gene:CG14535 / 34073 FlyBaseID:FBgn0031955 Length:1131 Species:Drosophila melanogaster
Sequence 2:NP_651939.4 Gene:Kif3C / 43820 FlyBaseID:FBgn0039925 Length:649 Species:Drosophila melanogaster


Alignment Length:401 Identity:81/401 - (20%)
Similarity:154/401 - (38%) Gaps:109/401 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 VKVMLRV-----ADRDRNSGGTEPDFMALDKKKRQVTLTDPRTACPPPQAAQERAPMVAAPKMFA 104
            :||::|.     .:::||...      .::..:..|::|:|             :..::..|.|.
  Fly     5 IKVVVRCRPMNQTEKERNCQN------IVEINEFAVSVTNP-------------SARISQQKKFI 50

  Fly   105 FDNLFTGEDKQSDVCASALSEVIPAVLEGSDGCLLAMGYPATGQAQTVLGELGGGSGSGSASGSG 169
            ||:::..:.....:.......::.:.:||.:|.:.|.|....|:..|:.|:            ..
  Fly    51 FDSVYNMKTDTEVIYDEMCYSLVESTIEGYNGTIFAYGQTGCGKTHTMQGD------------EN 103

  Fly   170 VACSLGAAPCAIAWLYKGIQERRQKSGARFSVRVSAVGVSATKPDALSQDLL--------ISHAA 226
            .:.|.|..|.....:::.|.   ..:..|:...|:.:.:...:    .:|||        |:|..
  Fly   104 FSNSTGIIPKCFDHIFERIS---MTTNVRYLALVTYLEIYNER----IRDLLNKNENTNVINHFL 161

  Fly   227 ESDDSPGIYLRDDFLGGPTELRAP--TAERAALFLDSALAGRLKSSGSTASGSSGCAAPLESALI 289
            :  :.|||     .:..||....|  .|.:...:|......|:.::......||      .|..|
  Fly   162 K--ELPGI-----GVSVPTLTTQPVVNANQCYDWLHFGNKNRVTAATLMNKNSS------RSHTI 213

  Fly   290 FTLHVYQYS-LSRKGGVAGG---RSRLHIIDLGGC-ANRNGG-------------LPLSGIGNIL 336
            ||:.:.|.. |:..|..|.|   |.:|.::||.|. ..|..|             |.||.:||::
  Fly   214 FTITLEQSPFLNSIGSDAFGGICRGKLSLVDLAGSERQRKTGAQGDRLKEASQINLSLSALGNVI 278

  Fly   337 LAILSGQ-RHPPHKDHPLTPLLKD------------CLAPITCHVAIVAHVRPEQSYQDALSTIQ 388
            .:::.|: :|.|.:|..||.||:|            |::|...|            |.:.:||::
  Fly   279 SSLVDGKAKHVPFRDSKLTRLLQDSLGGNTKTLMISCISPTDIH------------YDETISTLR 331

  Fly   389 IASRIHRLRRR 399
            .|||...:..:
  Fly   332 YASRAKNISNK 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14535NP_001285726.1 Motor_domain 44..394 CDD:277568 81/394 (21%)
Kif3CNP_651939.4 Motor_domain 3..339 CDD:277568 81/396 (20%)
Kinesin 10..339 CDD:278646 79/391 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4280
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24115
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.