DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14535 and Klp64D

DIOPT Version :9

Sequence 1:NP_001285726.1 Gene:CG14535 / 34073 FlyBaseID:FBgn0031955 Length:1131 Species:Drosophila melanogaster
Sequence 2:NP_523934.1 Gene:Klp64D / 38611 FlyBaseID:FBgn0004380 Length:677 Species:Drosophila melanogaster


Alignment Length:504 Identity:123/504 - (24%)
Similarity:197/504 - (39%) Gaps:120/504 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 VGKVKVMLRVADRDRN--SGGTEPDFMALDKKKRQVTLTDPRTACPPPQAAQERAPMVAAPKMFA 104
            :..|:|::|....|:|  |.|. ...:::||..|.:|:..|......|            ||.:.
  Fly    18 IENVRVVVRTRPMDKNELSAGA-LSAISVDKINRAITVMKPNATANEP------------PKTYY 69

  Fly   105 FDNLFTGEDKQSDVCASALSEVIPAVLEGSDGCLLAMGYPATGQAQTVLGELGGGSGSGSASGSG 169
            |||:|.|...|.|:.......::..||||.:|.:||.|...||:..|    :.|...|....   
  Fly    70 FDNVFDGGSNQMDLYVDTARPIVDKVLEGYNGTILAYGQTGTGKTYT----MSGNPDSPQTK--- 127

  Fly   170 VACSLGAAPCAIAWLYKGIQERRQKSGARFSVRVSAVGV-SATKPDALSQDLLISHAAESDDSP- 232
                 |..|.|.|.::..|  .:.|...:|.||||.:.: :....|.|.:|  :..:.|..:.| 
  Fly   128 -----GIIPNAFAHIFGHI--AKAKENQKFLVRVSYMEIYNEEVRDLLGKD--VGKSLEVKERPD 183

  Fly   233 -GIYLRDDFLGGPTELRAPTAERAALFLDSALAGRLKSSGSTASGSSGCAAPLESALIFTLHVYQ 296
             |::::|  |.|.....|...|..     ..|..:.::.|:|.......    .|..||::.|.:
  Fly   184 IGVFVKD--LSGYVVHNADDLENI-----MRLGNKNRAVGATKMNQESS----RSHAIFSITVER 237

  Fly   297 YSLSRKGGVAGGR-SRLHIIDLGGCANRNG--------------GLPLSGIGNILLAILSGQ-RH 345
            ..|. :|.|...| .:|.::||.|...::.              .|.||.:||::.|::.|: .|
  Fly   238 SELG-EGDVQHVRMGKLQLVDLAGSERQSKTQASGQRLKEATKINLSLSVLGNVISALVDGKSTH 301

  Fly   346 PPHKDHPLTPLLKDCLA----PITCHVAIVAHVRP-EQSYQDALSTIQIASRIHRLRRRKHRVPM 405
            .|:::..||.||:|.|.    .:.|     |.:.| :.:|.:.:||::.|||...::.|.|....
  Fly   302 IPYRNSKLTRLLQDSLGGNSKTVMC-----ATISPADSNYMETISTLRYASRAKNIQNRMHINEE 361

  Fly   406 P--------------LAVGLAQGLGGNGSSAGSGADPSSSEISADTVIYMGPNDDATDGEHP-PV 455
            |              |...|.:|       .....:|.|||...||.      ||  :.|.| .:
  Fly   362 PKDALLRHFQEEIARLRKQLEEG-------DSLEEEPPSSEEEEDTA------DD--ELEAPLEI 411

  Fly   456 YLPSLTAGDNRGVMSKALKGSGLEKPPSKSASNSPMMMKKAMAAEKAKK 504
            .|.|.|.             ..:||.|.|....:     .|...|.||:
  Fly   412 ELESSTI-------------QAVEKKPKKKREKT-----DAEKEELAKR 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14535NP_001285726.1 Motor_domain 44..394 CDD:277568 96/375 (26%)
Klp64DNP_523934.1 KISc_KIF3 19..352 CDD:276822 96/378 (25%)
Kinesin 26..352 CDD:278646 94/371 (25%)
RILP-like <437..556 CDD:304877 3/6 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4280
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24115
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.