DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14535 and Klp59D

DIOPT Version :9

Sequence 1:NP_001285726.1 Gene:CG14535 / 34073 FlyBaseID:FBgn0031955 Length:1131 Species:Drosophila melanogaster
Sequence 2:NP_611762.1 Gene:Klp59D / 37674 FlyBaseID:FBgn0034827 Length:729 Species:Drosophila melanogaster


Alignment Length:385 Identity:87/385 - (22%)
Similarity:141/385 - (36%) Gaps:90/385 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 FAFDNLFTGEDKQSDVCASAL------SEVIPAVLEGSDGCLLAMGYPATGQAQTVLGELGGGSG 161
            |.||..|..|      |::||      ..:|..:.||.:....|.|...:|:..|:.||.     
  Fly   284 FRFDYTFDEE------CSNALVYDHTARPLIRTMFEGGNATCFAYGQTGSGKTHTMGGEF----- 337

  Fly   162 SGSASGSGVACSLGAAPCAIAWLYKGIQ--ERRQKSGARFSVRVSAVGVSATKPDALSQDLLISH 224
                .|....|..|....|...:::.:.  |.|| .||:  :..|...:..||    ..|||:  
  Fly   338 ----FGKVQDCGTGIYAMAARDVFEEVSRPEYRQ-MGAK--ITCSFFEIYGTK----VFDLLL-- 389

  Fly   225 AAESDDSPGIYLRDD-----FLGGPTELRAPTAERAALFLDSALAGRLKSSGSTASGSSGCAAPL 284
                .:.|.:.:.:|     .:.|.||:.....|.....::.....|.....|..:.||...|..
  Fly   390 ----PNKPMLRVLEDARQQVVVVGLTEMPVTKVEDVLRLIEHGSKERTSGQTSANAKSSRSHAVF 450

  Fly   285 ESALIFTLHVYQYSLSRKGGVAGGRSRLHIIDLGG--------CANRNGGLPLSGIGNILLAI-- 339
            :.||.|.            ...|...:...:||.|        .|:|...:..:.|...|||:  
  Fly   451 QIALHFP------------DSWGPHGKCSFVDLAGNERGADTQSADRQTRIEGAEINKSLLALKE 503

  Fly   340 ----LSGQ-RHPPHKDHPLTPLLKDCLA----PITCHVAIVAHVRPEQS-YQDALSTIQIASRIH 394
                ||.| .|.|.:...||.:|:|...    ..||.:|:::   |..| .::.|:|::.|.|:.
  Fly   504 CIRALSRQSSHLPFRGSKLTQVLRDSFVGGKKNKTCMIAMIS---PSMSCVENTLNTLRYADRVK 565

  Fly   395 RL--RRRKHRVPMPLAVGLAQGLGGNGSSAGSGADPSSSEISADTVIYMGPNDDATDGEH 452
            .|  :..:|          .|.:.|:|..:....:.|..|:.||......|.|:  |.:|
  Fly   566 ELIAKEDEH----------LQSVEGDGEKSPDLNEESEPEMMADEEGDEEPEDE--DNQH 613

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14535NP_001285726.1 Motor_domain 44..394 CDD:277568 74/323 (23%)
Klp59DNP_611762.1 KISc_KIF2_like 233..565 CDD:276818 74/323 (23%)
Kinesin 239..566 CDD:278646 74/324 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24115
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.