DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14537 and CG16782

DIOPT Version :10

Sequence 1:NP_609155.1 Gene:CG14537 / 34072 FlyBaseID:FBgn0031954 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_570057.1 Gene:CG16782 / 31313 FlyBaseID:FBgn0029659 Length:200 Species:Drosophila melanogaster


Alignment Length:193 Identity:61/193 - (31%)
Similarity:99/193 - (51%) Gaps:13/193 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VYNGLLLASAVCTGRKMLPEEHPFAMVACVVVGFSAVFGLLRVIFASG--QPEECQQLRDITSGV 75
            |.|.:|..:|.....|:.|.|||:|..|||......:|||     |||  ..:..:::.:.|:.:
  Fly    10 VLNVVLCGAAGFGFYKIGPSEHPYAFTACVFGFCHGLFGL-----ASGLTGDDNAKKIAETTTSI 69

  Fly    76 LELAPLPLANMDFYMQSTGLSPIALGHAFFVLPLFCDLGCSLAK----DRRDCAFSDSLRNLTVL 136
            :|:.||||.|::.|:.:.. :.|||||..|::||...:..:..|    |..:....|:|:.||:|
  Fly    70 MEIIPLPLVNVELYLAAES-NNIALGHGLFIVPLAVSVILTFFKGESGDESEGGPLDTLKTLTIL 133

  Fly   137 GNIVSLGFLAYVERNFLYLRMVLVMIVVKYGV-VLVDSIKEDAGEDLQVCGTALFMHLLGKAV 198
            |||.||.:||..|.::....|.::..:.|:|. ...:.|.|.:||.:.....:.|..|...||
  Fly   134 GNITSLAYLAINESSWNLGGMAILAFMAKFGAKFFEEQISEGSGEPVNYLSWSGFYFLTAMAV 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14537NP_609155.1 DUF4791 31..197 CDD:406447 54/172 (31%)
CG16782NP_570057.1 DUF4791 28..195 CDD:406447 54/172 (31%)

Return to query results.
Submit another query.