DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rack1 and Wdr31

DIOPT Version :9

Sequence 1:NP_001260218.1 Gene:Rack1 / 34070 FlyBaseID:FBgn0020618 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_001277450.1 Gene:Wdr31 / 71354 MGIID:1918604 Length:367 Species:Mus musculus


Alignment Length:278 Identity:76/278 - (27%)
Similarity:116/278 - (41%) Gaps:41/278 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 HNGWVTQIATNPKDPDTIISASRDKTLIV--WKLTRDEDTNYGYPQKRLYGHSHFISDVVLSSDG 76
            |...|:.|||  .:.|..||..:|||.:.  ||.        |...||..||...|:.:......
Mouse    61 HVDTVSVIAT--LNSDLCISGGKDKTAVAYNWKT--------GRMVKRFTGHEREITKIACIPKA 115

  Fly    77 NYALSGSWDQTLRLWDLAAGKTTR-RFEGHTKDVLSVAFSADNRQIVSGSRDKTIKLWNT-LAEC 139
            |...|.|.|:|:.:|||......| :..||...|..:|.|.|:.|:.:||||.::.||:. ..:|
Mouse   116 NQFFSASRDKTVLMWDLQGSSHPRQQLSGHAMVVTGLAVSPDSSQLCTGSRDNSLLLWDVGTGQC 180

  Fly   140 --KFTIQED--GHTDWVSCVRFSPNHSNPIIVSCGWDRTVKVWNLANCKLKNNHHGHNGYLNTVT 200
              :.::..:  .|..||.        |.|.||....|:|:::|:....::.:.............
Mouse   181 VERASVSRNLVTHLCWVP--------SEPYIVQTSEDKTIRLWDSRGLQMAHMFPTKQHIQTHCE 237

  Fly   201 VSPDGSLCTS-----GGKDSKALLWDLNDGKNLYT--LEHNDIINALCFSPNRYWL-----CVAY 253
            ||.||..|.|     ||:..:|.||||...::...  ..|...:.:..|.|....|     ..|:
Mouse   238 VSVDGHTCISCSSGFGGEGCEATLWDLRQTRDRMCEYKGHFQTVASCVFLPKSTALMPMIATSAH 302

  Fly   254 GPSIKIWDL---ACKKTV 268
            ...:|||:.   ||..|:
Mouse   303 DSKVKIWNQDTGACLSTL 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rack1NP_001260218.1 WD40 7..312 CDD:238121 76/278 (27%)
WD40 repeat 18..62 CDD:293791 15/45 (33%)
WD40 repeat 68..104 CDD:293791 9/36 (25%)
WD40 repeat 109..145 CDD:293791 12/38 (32%)
WD40 repeat 153..190 CDD:293791 7/36 (19%)
WD40 repeat 196..232 CDD:293791 13/42 (31%)
WD40 repeat 237..280 CDD:293791 10/40 (25%)
WD40 repeat 287..311 CDD:293791
Wdr31NP_001277450.1 WD 1 60..100 16/48 (33%)
WD40 61..344 CDD:238121 76/278 (27%)
WD40 repeat 65..101 CDD:293791 15/45 (33%)
WD 2 101..140 11/38 (29%)
WD40 repeat 107..144 CDD:293791 9/36 (25%)
WD 3 144..183 14/38 (37%)
WD40 repeat 149..184 CDD:293791 12/34 (35%)
WD 4 186..225 10/46 (22%)
WD40 repeat 192..227 CDD:293791 10/42 (24%)
WD40 repeat 234..275 CDD:293791 13/40 (33%)
WD 5 276..319 10/42 (24%)
WD40 repeat 285..321 CDD:293791 10/36 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0279
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.