Sequence 1: | NP_001260218.1 | Gene: | Rack1 / 34070 | FlyBaseID: | FBgn0020618 | Length: | 318 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001277450.1 | Gene: | Wdr31 / 71354 | MGIID: | 1918604 | Length: | 367 | Species: | Mus musculus |
Alignment Length: | 278 | Identity: | 76/278 - (27%) |
---|---|---|---|
Similarity: | 116/278 - (41%) | Gaps: | 41/278 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 HNGWVTQIATNPKDPDTIISASRDKTLIV--WKLTRDEDTNYGYPQKRLYGHSHFISDVVLSSDG 76
Fly 77 NYALSGSWDQTLRLWDLAAGKTTR-RFEGHTKDVLSVAFSADNRQIVSGSRDKTIKLWNT-LAEC 139
Fly 140 --KFTIQED--GHTDWVSCVRFSPNHSNPIIVSCGWDRTVKVWNLANCKLKNNHHGHNGYLNTVT 200
Fly 201 VSPDGSLCTS-----GGKDSKALLWDLNDGKNLYT--LEHNDIINALCFSPNRYWL-----CVAY 253
Fly 254 GPSIKIWDL---ACKKTV 268 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rack1 | NP_001260218.1 | WD40 | 7..312 | CDD:238121 | 76/278 (27%) |
WD40 repeat | 18..62 | CDD:293791 | 15/45 (33%) | ||
WD40 repeat | 68..104 | CDD:293791 | 9/36 (25%) | ||
WD40 repeat | 109..145 | CDD:293791 | 12/38 (32%) | ||
WD40 repeat | 153..190 | CDD:293791 | 7/36 (19%) | ||
WD40 repeat | 196..232 | CDD:293791 | 13/42 (31%) | ||
WD40 repeat | 237..280 | CDD:293791 | 10/40 (25%) | ||
WD40 repeat | 287..311 | CDD:293791 | |||
Wdr31 | NP_001277450.1 | WD 1 | 60..100 | 16/48 (33%) | |
WD40 | 61..344 | CDD:238121 | 76/278 (27%) | ||
WD40 repeat | 65..101 | CDD:293791 | 15/45 (33%) | ||
WD 2 | 101..140 | 11/38 (29%) | |||
WD40 repeat | 107..144 | CDD:293791 | 9/36 (25%) | ||
WD 3 | 144..183 | 14/38 (37%) | |||
WD40 repeat | 149..184 | CDD:293791 | 12/34 (35%) | ||
WD 4 | 186..225 | 10/46 (22%) | |||
WD40 repeat | 192..227 | CDD:293791 | 10/42 (24%) | ||
WD40 repeat | 234..275 | CDD:293791 | 13/40 (33%) | ||
WD 5 | 276..319 | 10/42 (24%) | |||
WD40 repeat | 285..321 | CDD:293791 | 10/36 (28%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0279 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |