DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rack1 and wdr31

DIOPT Version :9

Sequence 1:NP_001260218.1 Gene:Rack1 / 34070 FlyBaseID:FBgn0020618 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_001093507.1 Gene:wdr31 / 568862 ZFINID:ZDB-GENE-070705-229 Length:342 Species:Danio rerio


Alignment Length:276 Identity:70/276 - (25%)
Similarity:110/276 - (39%) Gaps:70/276 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GHNGWVTQIATNPKDPDTIISASRDKTLIVWKLTRDEDTNYGYPQKRLYGHSHFISDVVLSSDGN 77
            |||..:|::... |....|.|||||||:::|.|.||.:.     .:...||...::.|.:|.||:
Zfish    76 GHNREITKLCCF-KGSSLIFSASRDKTVLMWDLGRDTEA-----IQEFSGHELVVNGVAVSPDGS 134

  Fly    78 YALSGSWDQTLRLWDLAAGKTTRRFEGHTKDVLSVAFSADNRQIVSGSRDKTIKLW--------N 134
            ...:||.|.::.|||:.:|:..:|.......|..|.:...:..||..|.||||::|        |
Zfish   135 KLCTGSRDNSMCLWDIESGECLQRNTISRNLVTHVCWVPGSTSIVQTSEDKTIRVWDSRTWQVTN 199

  Fly   135 TLAE----------------------------CKFTI-----------QEDGHTDWVSCVRFSPN 160
            |...                            |:.|:           :..||....:|..|.|.
Zfish   200 TFPAKQYIQTHCDVNANCYHLLSSSNGFGGQGCEATLWDLRQPGCKVAEYRGHLQTTACCVFVPT 264

  Fly   161 HSN--PIIVSCGWDRTVKVW--NLANCKLKNNHHGHNGYLNTVTVSPDGSLCTSGGKDSKALLW- 220
            ...  .::.|..:|.:||:|  |.|.|            |.|:|:...|.|.:....||.:||. 
Zfish   265 RPGCPALVASSSYDSSVKIWDQNTAAC------------LYTLTLDGSGPLVSLAPCDSSSLLCA 317

  Fly   221 DLNDGKNLYTLEHNDI 236
            ..|.|.:...|:.:.:
Zfish   318 SFNTGLHQLHLDQSAV 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rack1NP_001260218.1 WD40 7..312 CDD:238121 70/276 (25%)
WD40 repeat 18..62 CDD:293791 14/43 (33%)
WD40 repeat 68..104 CDD:293791 12/35 (34%)
WD40 repeat 109..145 CDD:293791 14/82 (17%)
WD40 repeat 153..190 CDD:293791 11/40 (28%)
WD40 repeat 196..232 CDD:293791 11/36 (31%)
WD40 repeat 237..280 CDD:293791 70/276 (25%)
WD40 repeat 287..311 CDD:293791
wdr31NP_001093507.1 WD40 36..>318 CDD:225201 67/259 (26%)
WD40 36..317 CDD:238121 67/258 (26%)
WD40 repeat 82..119 CDD:293791 14/42 (33%)
WD40 repeat 124..159 CDD:293791 11/34 (32%)
WD40 repeat 167..202 CDD:293791 11/34 (32%)
WD40 repeat 209..250 CDD:293791 2/40 (5%)
WD40 repeat 260..296 CDD:293791 12/47 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0279
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.