DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rack1 and T05A8.5

DIOPT Version :9

Sequence 1:NP_001260218.1 Gene:Rack1 / 34070 FlyBaseID:FBgn0020618 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_494344.1 Gene:T05A8.5 / 173617 WormBaseID:WBGene00020231 Length:378 Species:Caenorhabditis elegans


Alignment Length:238 Identity:56/238 - (23%)
Similarity:94/238 - (39%) Gaps:45/238 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 HNGWVTQIATNP------KDPDTIISASRDKTLIVWKLTRDEDTNYGYPQKRLYGHSHFISDVVL 72
            ||.|......|.      ....::|:|.|:.||..|....:..   ..|.....||...::.|| 
 Worm    90 HNMWSNSCEINKICYRNFIAKHSLIAAGRNGTLTHWMFNHEPG---DLPNVVFDGHKFGVTGVV- 150

  Fly    73 SSDGNYALSGSWDQTLRLWDLAAGKTTRRFEGHTKDVLSVAFSADNRQIVSGSRDKTIKLW---- 133
            |.:.|..:|||.|.::::|||.:.|..|....:...|..:|::.:  .:...|.||:::||    
 Worm   151 SINENQFMSGSRDCSVKIWDLESAKCVRTQTINRNLVTHMAYNGN--LVAQTSEDKSVRLWDPRN 213

  Fly   134 -NTLAE----------CKFTIQEDGHTDWVSCVRFSPNHSNPIIVSCGWDRTVKVWNLANCKLKN 187
             :.:.|          |:|    ||...:.||   |...:|.   .|    .:..:::.|.:...
 Worm   214 ASVVTEFPRKRHIQMFCEF----DGANRFFSC---SNGFNND---GC----EITSYDVRNPRQSR 264

  Fly   188 NHHGHNG---YLNTVTVSPDGSLCTSGGKDSKALLWDL-NDGK 226
            ...||.|   .|:.|.:.....|..|...|.:..||.: .||:
 Worm   265 EARGHEGNVTSLSIVQMDQTKRLLASVSADRQIRLWKIEEDGQ 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rack1NP_001260218.1 WD40 7..312 CDD:238121 56/238 (24%)
WD40 repeat 18..62 CDD:293791 8/49 (16%)
WD40 repeat 68..104 CDD:293791 13/35 (37%)
WD40 repeat 109..145 CDD:293791 10/50 (20%)
WD40 repeat 153..190 CDD:293791 6/36 (17%)
WD40 repeat 196..232 CDD:293791 9/32 (28%)
WD40 repeat 237..280 CDD:293791
WD40 repeat 287..311 CDD:293791
T05A8.5NP_494344.1 WD40 54..301 CDD:392136 53/230 (23%)
WD40 repeat 147..182 CDD:293791 13/35 (37%)
WD40 repeat 187..221 CDD:293791 8/35 (23%)
WD40 repeat 227..267 CDD:293791 10/53 (19%)
WD40 263..>345 CDD:392136 12/45 (27%)
WD40 repeat 276..317 CDD:293791 9/32 (28%)
WD40 repeat 324..364 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0279
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.