DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and PPM1F

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_055449.1 Gene:PPM1F / 9647 HGNCID:19388 Length:454 Species:Homo sapiens


Alignment Length:459 Identity:111/459 - (24%)
Similarity:174/459 - (37%) Gaps:148/459 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 VLLLYLQAVDVWSRSILGRIQATLGRQKAVKMMELSASAGDHQSWEEMKQQSSAFAVLGRRPRME 124
            |.||..|::   ::|...|:....|:.:  |.:.|:|.|...| |     ..|..|:...|.:||
Human   117 VTLLDAQSL---AQSFFNRLWEVAGQWQ--KQVPLAARASQRQ-W-----LVSIHAIRNTRRKME 170

  Fly   125 DRFIIEENINNNTGIS------FFAVFDGHGGEFAADFAKDVLVKNIYNKIIEMSKLLKTEGNSG 183
            ||.:...:.|...|:|      :|||||||||..||.:|                 .:....|:.
Human   171 DRHVSLPSFNQLFGLSDPVNRAYFAVFDGHGGVDAARYA-----------------AVHVHTNAA 218

  Fly   184 DYDKSPYLARKQSRKDANKENTEPTAGVMRKDSLRKAHSTTADCSAIKQKTTEASIADIYTVQLN 248
            ...:.|               |:|.                                        
Human   219 RQPELP---------------TDPE---------------------------------------- 228

  Fly   249 SAMRASGNLGAAKDSFLNNNNNGQNGAANAPPPNYEAKCYIEHGRINFGKLITDEIMSADYKLVE 313
                     ||.:::|..                                  ||::      .:.
Human   229 ---------GALREAFRR----------------------------------TDQM------FLR 244

  Fly   314 QAKRATNIAGTTALIAIVQGSKLIVANVGDSRGVMYDWRGIAIPLSFDHKPQQVRERKRIHDAGG 378
            :|||....:|||.:.|::.|:.|.||.:|||:.::.. :|..:.|...|:|::..|:.||...||
Human   245 KAKRERLQSGTTGVCALIAGATLHVAWLGDSQVILVQ-QGQVVKLMEPHRPERQDEKARIEALGG 308

  Fly   379 FIAFRGVWRVAGVLATSRALGDYPLKDKNLVIATPDILTFELNDHKPHFLILASDGLWDTFSNEE 443
            |::....|||.|.||.|||:||  :..|..|....|..:..|...: .:|:||.||.:|...::|
Human   309 FVSHMDCWRVNGTLAVSRAIGD--VFQKPYVSGEADAASRALTGSE-DYLLLACDGFFDVVPHQE 370

  Fly   444 ACTFALEHL-KEPDFG---AKSLAMESYKRGSVDNITVLVIVFKNDVYKIGSSAGKAGEESLKVP 504
            .......|| ::...|   |:.|...:.:|||.|||||:| ||..|..:: ...|..||...:..
Human   371 VVGLVQSHLTRQQGSGLRVAEELVAAARERGSHDNITVMV-VFLRDPQEL-LEGGNQGEGDPQAE 433

  Fly   505 AKSQ 508
            .:.|
Human   434 GRRQ 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 91/380 (24%)
PPM1FNP_055449.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
PP2C 155..406 CDD:278884 87/380 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 419..454 4/20 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X119
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.