DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and pphC

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_416576.1 Gene:pphC / 947269 ECOCYCID:G7111 Length:253 Species:Escherichia coli


Alignment Length:67 Identity:18/67 - (26%)
Similarity:26/67 - (38%) Gaps:10/67 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   386 WRV--AGVLATSRALGDYPLKDK-NLVIATPDILTFELNDHKPHFLILASDGLWDTFSNEEACTF 447
            ||:  |..:.||....|.|.:|. .:.||.       |||.:|...:..:||........|....
E. coli     3 WRLVYASTVGTSHISADLPCQDACQMQIAW-------LNDQQPLLSVFVADGAGSVSQGGEGAML 60

  Fly   448 AL 449
            |:
E. coli    61 AV 62

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 18/67 (27%)
pphCNP_416576.1 PP2C_2 11..219 CDD:404547 15/59 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.