powered by:
Protein Alignment CG7115 and pphC
DIOPT Version :9
Sequence 1: | NP_001260216.1 |
Gene: | CG7115 / 34069 |
FlyBaseID: | FBgn0027515 |
Length: | 524 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_416576.1 |
Gene: | pphC / 947269 |
ECOCYCID: | G7111 |
Length: | 253 |
Species: | Escherichia coli |
Alignment Length: | 67 |
Identity: | 18/67 - (26%) |
Similarity: | 26/67 - (38%) |
Gaps: | 10/67 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 386 WRV--AGVLATSRALGDYPLKDK-NLVIATPDILTFELNDHKPHFLILASDGLWDTFSNEEACTF 447
||: |..:.||....|.|.:|. .:.||. |||.:|...:..:||........|....
E. coli 3 WRLVYASTVGTSHISADLPCQDACQMQIAW-------LNDQQPLLSVFVADGAGSVSQGGEGAML 60
Fly 448 AL 449
|:
E. coli 61 AV 62
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG7115 | NP_001260216.1 |
PP2Cc |
111..482 |
CDD:238083 |
18/67 (27%) |
pphC | NP_416576.1 |
PP2C_2 |
11..219 |
CDD:404547 |
15/59 (25%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0631 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.