DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and PTC2

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_011013.1 Gene:PTC2 / 856823 SGDID:S000000891 Length:464 Species:Saccharomyces cerevisiae


Alignment Length:437 Identity:105/437 - (24%)
Similarity:158/437 - (36%) Gaps:182/437 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 AVLGRRPRMEDRFIIEENI---NNNTGISFFAVFDGHGGEFAADFAKDVLVKNIYNKIIEMSKLL 176
            |:.|.|..|||..|:|.|:   ::...|:|:.:||||||...|::..        |||:|:.:..
Yeast    28 AMQGWRMSMEDSHILEPNVLTKSDKDHIAFYGIFDGHGGAKVAEYCG--------NKIVEILQEQ 84

  Fly   177 KT--EGNSGDYDKSPYLARKQSRKDANKENTEPTAGVMRKDSLRKAHSTTADCSAIKQKTTEASI 239
            |:  |||         |.|                                              
Yeast    85 KSFHEGN---------LPR---------------------------------------------- 94

  Fly   240 ADIYTVQLNSAMRASGNLGAAKDSFLNNNNNGQNGAANAPPPNYEAKCYIEHGRINFGKLITDEI 304
                               |..|:|:|.:                            .||:.|.:
Yeast    95 -------------------ALIDTFINTD----------------------------VKLLQDPV 112

  Fly   305 MSADYKLVEQAKRATNIAGTTALIAIVQGSK--LIVANVGDSRGVMYDWRGIAIPLSFDHKPQQV 367
            |..|:            :|.||...:|..|:  |:..|.||||.|:.. .|.|..||:||||...
Yeast   113 MKEDH------------SGCTATSILVSKSQNLLVCGNAGDSRTVLAT-DGNAKALSYDHKPTLA 164

  Fly   368 RERKRIHDAGGFIAFRGVWRVAGVLATSRALGDYPLK-------DKNLVIATPDILTFELNDHKP 425
            .|:.||..|.||:...   ||.|.||.|||:||:..|       ::.:|...||||...|:..:.
Yeast   165 SEKSRIVAADGFVEMD---RVNGNLALSRAIGDFEFKSNPKLGPEEQIVTCVPDILEHSLDYDRD 226

  Fly   426 HFLILASDGLWDTFSNEEACTFALEHLKEPDFGAKSLAMESYKRGSV-------------DNITV 477
            .|:|||.||:||..::::........|:|    .|:|...|.:...|             ||:::
Yeast   227 EFVILACDGIWDCLTSQDCVDLVHLGLRE----GKTLNEISSRIIDVCCAPTTEGTGIGCDNMSI 287

  Fly   478 LVIVFKNDVYKIGSSAGKAGEESLKVPAKSQPVAPAVVQRSNSIKTK 524
            :|:...           |.||:              |.|.|:.:|:|
Yeast   288 VVVALL-----------KEGED--------------VAQWSDRMKSK 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 97/393 (25%)
PTC2NP_011013.1 PP2C 23..279 CDD:395385 94/380 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.