DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and PTC5

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_014733.1 Gene:PTC5 / 854257 SGDID:S000005616 Length:572 Species:Saccharomyces cerevisiae


Alignment Length:372 Identity:80/372 - (21%)
Similarity:118/372 - (31%) Gaps:158/372 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 EDRFIIEENINNNTGISFFAVFDGHGGEFAADFAKDVLVKNIYNKIIEMSKLLKTEGNSGDYDKS 188
            ||...||::      :.||.:||||||.|.::                  ||.|        |..
Yeast   181 EDGKSIEKD------LYFFGIFDGHGGPFTSE------------------KLSK--------DLV 213

  Fly   189 PYLARKQSRKDANKENTEPTAGVMRKDSLRKAHSTTADCSAIKQKTTEASIADIYTVQLNSAMRA 253
            .|:|.:                                                           
Yeast   214 RYVAYQ----------------------------------------------------------- 219

  Fly   254 SGNLGAAKDSFLNNNNNGQNGAANAPPPNYEAKCYIEHGRINFGKLITDEIMSADYKLVEQAKRA 318
               ||...|         ||.......||......|..|   |.||..|.::.:..||.:.... 
Yeast   220 ---LGQVYD---------QNKTVFHSDPNQLIDSAISKG---FLKLDNDLVIESFRKLFQDPNN- 268

  Fly   319 TNIA-------GTTALIAIVQGSKLI--VANVGDSRGVMY------DWRGIAIPLSFDHKPQQVR 368
            ||||       |:.||:::...:..|  ||..||||.::.      :|  ....||.|.....:.
Yeast   269 TNIANTLPAISGSCALLSLYNSTNSILKVAVTGDSRALICGLDNEGNW--TVKSLSTDQTGDNLD 331

  Fly   369 ERKRI---HDAGGFIAFRGVWRVAGVLATSRALGDYPLKDKNL---------------------- 408
            |.:||   |.....:...|  |:.|.|..|||.|||..|.|.:                      
Yeast   332 EVRRIRKEHPGEPNVIRNG--RILGSLQPSRAFGDYRYKIKEVDGKPLSDLPEVAKLYFRREPRD 394

  Fly   409 ------VIATPDILTFELNDHKPHFLILASDGLWDTFSNEEACTFAL 449
                  |.|.|.|.:.::.:: ..|:::.||||::..:|||..:..:
Yeast   395 FKTPPYVTAEPVITSAKIGEN-TKFMVMGSDGLFELLTNEEIASLVI 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 80/372 (22%)
PTC5NP_014733.1 PP2C 182..464 CDD:395385 79/371 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X119
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.