DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and PPM1D

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_003611.1 Gene:PPM1D / 8493 HGNCID:9277 Length:605 Species:Homo sapiens


Alignment Length:406 Identity:93/406 - (22%)
Similarity:143/406 - (35%) Gaps:168/406 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 TGISFFAVFDGHGGEFAADFAKDVLVKNIYNKIIEMSKLLKTEGNSGDYDKSPYLARKQSRKDAN 201
            :.::||||.|||||..||.||::.|...|                               :|...
Human    96 SSVAFFAVCDGHGGREAAQFAREHLWGFI-------------------------------KKQKG 129

  Fly   202 KENTEPTAGVMRKDSLRKAHSTTADCSAIKQKTTEASIADIYTVQLNSAMRASGNLGAAKDSFLN 266
            ..::|| |.|               |:||::                              .|| 
Human   130 FTSSEP-AKV---------------CAAIRK------------------------------GFL- 147

  Fly   267 NNNNGQNGAANAPPPNYEAKCYIEHGRINFGKLITDEIMSADYKLVEQAKRATNI---AGTTALI 328
                               .|::...:                ||.|..|..|.:   :||||.:
Human   148 -------------------ACHLAMWK----------------KLAEWPKTMTGLPSTSGTTASV 177

  Fly   329 AIVQGSKLIVANVGDSRGVMYDWRGI----------AIPLSFDHKPQQVRERKRIHDAGGFI--- 380
            .|::|.|:.||:||||..|:    ||          |:.::.||||:..:||:||...||.:   
Human   178 VIIRGMKMYVAHVGDSGVVL----GIQDDPKDDFVRAVEVTQDHKPELPKERERIEGLGGSVMNK 238

  Fly   381 --AFRGVWRVAGV-----------------LATSRALGD---YPLKDKNLVIA-TPDILTFELND 422
              ..|.||:...:                 ||.:|||||   |.......|:: .||.....|:.
Human   239 SGVNRVVWKRPRLTHNGPVRRSTVIDQIPFLAVARALGDLWSYDFFSGEFVVSPEPDTSVHTLDP 303

  Fly   423 HKPHFLILASDGLWDTFSNEEACTFALEHLKEP----DFG---AKSLAMESYKRG-----SVDNI 475
            .|..::||.|||||:....::|.:...:..::.    :.|   ||.|...:..|.     ..||.
Human   304 QKHKYIILGSDGLWNMIPPQDAISMCQDQEEKKYLMGEHGQSCAKMLVNRALGRWRQRMLRADNT 368

  Fly   476 TVLVIVFKNDVYKIGS 491
            :.:||....:|...|:
Human   369 SAIVICISPEVDNQGN 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 91/395 (23%)
PPM1DNP_003611.1 Interaction with CHEK1. /evidence=ECO:0000269|PubMed:15870257 1..101 0/4 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 28..90
PP2C 67..368 CDD:278884 88/388 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 516..591
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.