DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and AT1G68410

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001031252.1 Gene:AT1G68410 / 843170 AraportID:AT1G68410 Length:436 Species:Arabidopsis thaliana


Alignment Length:441 Identity:88/441 - (19%)
Similarity:154/441 - (34%) Gaps:162/441 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 KMMELSASAGDHQSWEEMKQQSSAFAVLGRRPRMEDRFIIEEN-----INNNTGISFFAVFDGHG 149
            |::.|:|.........:|::....|....:..:.||..:|:.:     .|::|..|.|||||||.
plant    17 KLVPLAALISRETKAAKMEKPIVRFGQAAQSRKGEDYVLIKTDSLRVPSNSSTAFSVFAVFDGHN 81

  Fly   150 GEFAADFAKDVLVKNIYNKIIEMSKLLKTEGNSGDYDKSPYLARKQSRKDANKENTEPTAGVMRK 214
            |:.||.:.::    |:.|.:|                                            
plant    82 GKAAAVYTRE----NLLNHVI-------------------------------------------- 98

  Fly   215 DSLRKAHSTTADCSAIKQKTTEASIADIYTVQLNSAMRASGNLGAAKDSFLNNNNNGQNGAANAP 279
                                              ||:.:    |.::|.:|:             
plant    99 ----------------------------------SALPS----GLSRDEWLH------------- 112

  Fly   280 PPNYEAKCYIEHGRINFGKLITDEIMSADYKLVEQAKRATNIAGTTALIAIVQGSKLIVANVGDS 344
                               .:...::|...|..::.:.....:||||...||.|..:.||.||||
plant   113 -------------------ALPRALVSGFVKTDKEFQSRGETSGTTATFVIVDGWTVTVACVGDS 158

  Fly   345 RGVMYDWRGIAIPLSFDHK-PQQVRERKRIHDAGGFIAFRGVWRVAGV-----------LATSRA 397
            |.::....|....|:.||: .....||:|:..:||.:....:  |.||           |..||:
plant   159 RCILDTKGGSVSNLTVDHRLEDNTEERERVTASGGEVGRLSI--VGGVEIGPLRCWPGGLCLSRS 221

  Fly   398 LGDYPLKDKNLVIATPDILTFELNDHKPHFLILASDGLWDTFSNEEA---CTFALEHLKEPDFGA 459
            :||..:.:  .::..|.:...:|::.... ||:||||:||..|:|.|   |...     ..:..|
plant   222 IGDMDVGE--FIVPVPFVKQVKLSNLGGR-LIIASDGIWDALSSEVAAKTCRGL-----SAELAA 278

  Fly   460 KSLAMESY-KRGSVDNITVLVIVFKNDVYKIGSSAGKAGEESLKVPAKSQP 509
            :.:..|:. :||..|:.|.:|:    |:..         .|:.:.|..|.|
plant   279 RQVVKEALRRRGLKDDTTCIVV----DIIP---------PENFQEPPPSPP 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 79/391 (20%)
AT1G68410NP_001031252.1 PP2Cc 49..302 CDD:238083 78/384 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.