DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and AT1G67820

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_176948.2 Gene:AT1G67820 / 843108 AraportID:AT1G67820 Length:445 Species:Arabidopsis thaliana


Alignment Length:465 Identity:105/465 - (22%)
Similarity:166/465 - (35%) Gaps:210/465 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 DHQSWEEMKQQS-------SAFAVL---GRRPRMEDRFIIEENINNNTGISFFAVFDGHGGEFAA 154
            |:.|:.:...|:       :.|.|:   |::..|||...|...:..|:..|||.|:|||||..||
plant   100 DYFSFTDFAHQNGTVSFGGNGFGVVSRNGKKKFMEDTHRIVPCLVGNSKKSFFGVYDGHGGAKAA 164

  Fly   155 DFAKDVLVKNIYNKIIEMSKLLKTEGNSGDYDKSPYLARKQSRKDANKENTEPTAGVMRKDSLRK 219
            :|    :.:|::..::||.:                                             
plant   165 EF----VAENLHKYVVEMME--------------------------------------------- 180

  Fly   220 AHSTTADCSAIKQKTTEASIADIYTVQLNSAMRASGNLGAAKDSFLNNNNNGQNGAANAPPPNYE 284
                  :|...::|                       :.|.|.:||..:.:              
plant   181 ------NCKGKEEK-----------------------VEAFKAAFLRTDRD-------------- 202

  Fly   285 AKCYIEHGRINFGKLITDEIMSADYKLVEQAKRATNIAGTTALIAIVQGSKLIVANVGDSRGVMY 349
               ::|.|                           .::|...:.|::|..::||:|:||.|.|:.
plant   203 ---FLEKG---------------------------VVSGACCVTAVIQDQEMIVSNLGDCRAVLC 237

  Fly   350 DWRGIAIPLSFDHKPQQVRERKRIHDAGGFI-AFRGVWRVAGVLATSRALGDYPLKDKNLVIATP 413
            . .|:|..|:.||||.:..|::||...||:: ..:|.|||.|:||.||::||..|  |..|:|.|
plant   238 R-AGVAEALTDDHKPGRDDEKERIESQGGYVDNHQGAWRVQGILAVSRSIGDAHL--KKWVVAEP 299

  Fly   414 DILTFELNDHKPHFLILASDGLWDTFSNEEACTFALEHL-------------------------- 452
            :....|| :....||:||||||||..||:||....|..|                          
plant   300 ETRVLEL-EQDMEFLVLASDGLWDVVSNQEAVYTVLHVLAQRKTPKESEEENLVQGFVNMSPSSK 363

  Fly   453 -------KEP---------------------DFGA-------------------KSLAMESYKRG 470
                   |.|                     :.|:                   |.||..:.|||
plant   364 LRRASLVKSPRCAKSQSYYYNSENESPSLNREIGSSPSKSPITPWKSLWAKAACKELANLAAKRG 428

  Fly   471 SVDNITVLVI 480
            |:|:|||::|
plant   429 SMDDITVVII 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 102/454 (22%)
AT1G67820NP_176948.2 PP2Cc 119..440 CDD:238083 102/446 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 149 1.000 Domainoid score I1420
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.