DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and AT1G47380

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_564504.1 Gene:AT1G47380 / 841141 AraportID:AT1G47380 Length:428 Species:Arabidopsis thaliana


Alignment Length:355 Identity:86/355 - (24%)
Similarity:146/355 - (41%) Gaps:77/355 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 KENTEPTAGVMRKDSLRKAHSTTADCSAIKQKTTEASIADIYTVQLNSAMRASGNLGAAKDSFLN 266
            :.:|.|.:.:::::|   |:....:...|..:..::...:.:|:......|..|: |....|.. 
plant     6 EHHTVPLSVLLKRES---ANEKIDNPELIHGQHNQSKKGEDFTLVKTECQRVMGD-GVTTFSVF- 65

  Fly   267 NNNNGQNGAANAPPPNYEAKCYIEHGRINF------GKLITDEIMSA------------DYKLVE 313
            ...:|.||:|        |..|.:...:|.      ..|..||.::|            |....|
plant    66 GLFDGHNGSA--------AAIYTKENLLNNVLAAIPSDLNRDEWVAALPRALVAGFVKTDKDFQE 122

  Fly   314 QAKRATNIAGTTALIAIVQGSKLIVANVGDSRGVMYDWRGIAIPLSFDHKPQ-QVRERKRIHDAG 377
            :|:    .:|||....||:|..:.||:|||||.::....|....||.||:.: ...||.|:..:|
plant   123 RAR----TSGTTVTFVIVEGWVVSVASVGDSRCILEPAEGGVYYLSADHRLEINEEERDRVTASG 183

  Fly   378 GFIAFRGV-----------WRVAGVLATSRALGDYPLKDKNLVIATPDILTFELNDHKPHFLILA 431
            |.:.....           |  .|.|..||::||..:.:  .::..|.:...:|:..... ||::
plant   184 GEVGRLNTGGGTEIGPLRCW--PGGLCLSRSIGDLDVGE--YIVPVPYVKQVKLSSAGGR-LIIS 243

  Fly   432 SDGLWDTFSNEEA--CTFALEHLKEPDFGAKSLAMESY-KRGSVDNITVLVIVFKNDVYKIGSSA 493
            |||:||..|.|||  |...|    .|:..|:.:..|:. |:|..|:.|.:|:    |:.      
plant   244 SDGVWDAISAEEALDCCRGL----PPESSAEHIVKEAVGKKGIRDDTTCIVV----DIL------ 294

  Fly   494 GKAGEESLKVPAKSQPVAPAVVQRSNSIKT 523
                  .|:.||.|.|  |...|....:|:
plant   295 ------PLEKPAASVP--PPKKQGKGMLKS 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 77/312 (25%)
AT1G47380NP_564504.1 PP2Cc 39..293 CDD:238083 72/280 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.