DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and AT1G18030

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_564045.1 Gene:AT1G18030 / 838383 AraportID:AT1G18030 Length:351 Species:Arabidopsis thaliana


Alignment Length:440 Identity:111/440 - (25%)
Similarity:167/440 - (37%) Gaps:165/440 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 QKAVKMMELS------ASAGDHQSWEE----MKQQSSAFAV-------LGRRPRMEDRFIIEENI 133
            :||.|..|:|      |:.|:.::.|:    :.::...|.|       .|.|..|||.:::..:.
plant    33 KKAKKSEEVSGGGEAVAAVGNREAEEDKPSFVSEEKKEFLVEADVAEDKGARHTMEDVWVVLPDA 97

  Fly   134 N----NNTGISFFAVFDGHGGEFAADFAKDVLVKNIYNKIIEMSKLLKTEGNSGDYDKSPYLARK 194
            :    .....:.||::|||||..||:|||..|..|:.                            
plant    98 SLDFPGTLRCAHFAIYDGHGGRLAAEFAKKHLHLNVL---------------------------- 134

  Fly   195 QSRKDANKENTEPTAGVMRKDSLRKAHSTTADCSAIKQKTTEASIADIYTVQLNSAMRASGNLGA 259
                         :||:.|:                        :.|:               ..
plant   135 -------------SAGLPRE------------------------LLDV---------------KV 147

  Fly   260 AKDSFLNNNNNGQNGAANAPPPNYEAKCYIEHGRINFGKLITDEIMSADYKLVEQAKRATNIAGT 324
            ||.:.|.                            .|.|  |||:      |::::.......|.
plant   148 AKKAILE----------------------------GFRK--TDEL------LLQKSVSGGWQDGA 176

  Fly   325 TALIAIVQGSKLIVANVGDSRGVM-----------YDWRG---IAIPLSFDHKPQQVRERKRIHD 375
            ||:...:...|:.|||:||::.|:           :...|   .||.|:.:||....:||.||..
plant   177 TAVCVWILDQKVFVANIGDAKAVLARSSTTNELGNHTEAGNPLKAIVLTREHKAIYPQERSRIQK 241

  Fly   376 AGGFIAFRGVWRVAGVLATSRALGDYPLKDKNLVIATPDILTFELNDHKPHFLILASDGLWDTFS 440
            :||.|:..|  |:.|.|..|||.||...| |..|.|||||..|||.: :.:|:||..||||:.|.
plant   242 SGGVISSNG--RLQGRLEVSRAFGDRHFK-KFGVSATPDIHAFELTE-RENFMILGCDGLWEVFG 302

  Fly   441 NEEACTFALEHLKEPDFG------AKSLAMESYK-RGSVDNITVLVIVFK 483
            ..:|..|..:.|||   |      ::.|..|:.| |...||.|.:|||||
plant   303 PSDAVGFVQKLLKE---GLHVSTVSRRLVKEAVKERRCKDNCTAIVIVFK 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 100/402 (25%)
AT1G18030NP_564045.1 PP2Cc 77..348 CDD:238083 98/393 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.