DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and AT1G09160

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_172388.1 Gene:AT1G09160 / 837436 AraportID:AT1G09160 Length:428 Species:Arabidopsis thaliana


Alignment Length:432 Identity:100/432 - (23%)
Similarity:156/432 - (36%) Gaps:170/432 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 MKQQSSAFAVLGRRPRMEDRFIIEENINN-----NTGISFFAVFDGHGGEFAADFAKDVLVKNIY 166
            :|...:|.|..|     ||.|:|:.:...     ::..|.|.:||||.|..||.:.|:.|::|: 
plant    34 VKYGQAALAKKG-----EDYFLIKTDCERVPGDPSSAFSVFGIFDGHNGNSAAIYTKEHLLENV- 92

  Fly   167 NKIIEMSKLLKTEGNSGDYDKSPYLARKQSRKDANKENTEPTAGVMRKDSLRKAHSTTADCSAIK 231
                                                                        .|||.
plant    93 ------------------------------------------------------------VSAIP 97

  Fly   232 QKTTEASIADIYTVQLNSAMRASGNLGAAKDSFLNNNNNGQNGAANAPPPNYEAKCYIEHGRINF 296
            |                         ||::|.:|           .|.|....|           
plant    98 Q-------------------------GASRDEWL-----------QALPRALVA----------- 115

  Fly   297 GKLITDEIMSADYKLVE-QAKRATNIAGTTALIAIVQGSKLIVANVGDSRGVMYDWRGIAIPLSF 360
            |.:.||         :| |.|..|  :|||....|:.|..:.||:|||||.::....|:...|:.
plant   116 GFVKTD---------IEFQQKGET--SGTTVTFVIIDGWTITVASVGDSRCILDTQGGVVSLLTV 169

  Fly   361 DHK-PQQVRERKRIHDAGGFI----AFRG-------VWRVAGVLATSRALGDYPLKDKNLVIATP 413
            ||: .:.|.||:||..:||.:    .|.|       .|  .|.|..||::||..:.:  .::..|
plant   170 DHRLEENVEERERITASGGEVGRLNVFGGNEVGPLRCW--PGGLCLSRSIGDTDVGE--FIVPIP 230

  Fly   414 DILTFELNDHKPHFLILASDGLWDTFSNEEACTFALEHLKEPDFGAKSLAMESYK-RGSVDNITV 477
            .:...:|.|.... ||:||||:||..|::.|.. |...| ..|..||.:..|:.: :|..|:.|.
plant   231 HVKQVKLPDAGGR-LIIASDGIWDILSSDVAAK-ACRGL-SADLAAKLVVKEALRTKGLKDDTTC 292

  Fly   478 LVIVFKNDVYKIGSSAGKAGEESLKVPAKSQPVAPAVVQRSN 519
            :|:    |:                ||:....:|||.:::.|
plant   293 VVV----DI----------------VPSGHLSLAPAPMKKQN 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 92/389 (24%)
AT1G09160NP_172388.1 PP2Cc 43..297 CDD:238083 90/388 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.860

Return to query results.
Submit another query.