DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and HAI2

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_172223.1 Gene:HAI2 / 837255 AraportID:AT1G07430 Length:442 Species:Arabidopsis thaliana


Alignment Length:456 Identity:108/456 - (23%)
Similarity:167/456 - (36%) Gaps:184/456 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 ATLGRQKAVKMMELSASAGDHQSWEEMKQQSSAFAVLGRRPRMED------RFIIEENINNNTGI 139
            |.:..:|.||..:|....|             ..:|.|||..|||      .|:.::...:.|..
plant   104 AVIPSKKTVKETDLRPRYG-------------VASVCGRRRDMEDAVALHPSFVRKQTEFSRTRW 155

  Fly   140 SFFAVFDGHGGEFAADFAKDVLVKNIYNKIIEMSKLLKTEGNSGDYDKSPYLARKQSRKDANKEN 204
            .:|.|:||||....|...|:           .:.:|::.|..|             .:|:..|:.
plant   156 HYFGVYDGHGCSHVAARCKE-----------RLHELVQEEALS-------------DKKEEWKKM 196

  Fly   205 TEPTAGVMRKDSLRKAHST-TADCSAIKQKTTEASIADIYTVQLNSAMRASGNLGAAKDSFLNNN 268
            .|.:...|.|:.:|...:. :|:|                                         
plant   197 MERSFTRMDKEVVRWGETVMSANC----------------------------------------- 220

  Fly   269 NNGQNGAANAPPPNYEAKCYIEHGRINFGKLITDEIMSADYKLVEQAKRATNIAGTTALIAIVQG 333
                             :|               |:.:.|...|          |:||:::::..
plant   221 -----------------RC---------------ELQTPDCDAV----------GSTAVVSVITP 243

  Fly   334 SKLIVANVGDSRGVMYDWRGIAIPLSFDHKPQQVRERKRIHDAGGFIAFRGVWRVAGVLATSRAL 398
            .|:||||.||||.|:.. .|.|:|||.||||.:..|..||.:|||.:.:....||.||||.|||:
plant   244 EKIIVANCGDSRAVLCR-NGKAVPLSTDHKPDRPDELDRIQEAGGRVIYWDGARVLGVLAMSRAI 307

  Fly   399 GDYPLKDKNLVIATPDILTFELNDHKPHFLILASDGLWDTFSNEEACTF---------------- 447
            ||..||.  .|.:.|::...:..: :..|||||:|||||..:||.|||.                
plant   308 GDNYLKP--YVTSEPEVTVTDRTE-EDEFLILATDGLWDVVTNEAACTMVRMCLNRKSGRGRRRG 369

  Fly   448 --------ALEHLKEPD---FGAKSLAMESYKRGSV----------------------DNITVLV 479
                    :.|..||.:   .|::    ::.|||.:                      ||::|:|
plant   370 ETQTPGRRSEEEGKEEEEKVVGSR----KNGKRGEITDKACTEASVLLTKLALAKHSSDNVSVVV 430

  Fly   480 I 480
            |
plant   431 I 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 102/426 (24%)
HAI2NP_172223.1 PP2Cc 116..431 CDD:214625 102/442 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.