DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and PP2C74

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001330834.1 Gene:PP2C74 / 833622 AraportID:AT5G36250 Length:462 Species:Arabidopsis thaliana


Alignment Length:425 Identity:95/425 - (22%)
Similarity:163/425 - (38%) Gaps:127/425 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 SAFAVLGRRPRMEDRFIIEENINNNTGISFFAVFDGHG--GEFAADFAKDVLVKNIYNKIIEMSK 174
            |.|:..|::...:|..|:.||..:.....|..||||||  |...|...:|:|...:         
plant    69 SLFSQQGKKGPNQDAMIVWENFGSMEDTVFCGVFDGHGPYGHIVAKRVRDLLPLKL--------- 124

  Fly   175 LLKTEGNSGDYDKSPYLARKQSRKDANKENTEPTAGVMRKDSLRKAHSTTADCSAIKQKTTEASI 239
                    |.:.:| |::.::..|:.:. ||:.          ||........||          
plant   125 --------GSHLES-YVSPEEVLKEISL-NTDD----------RKISEDLVHISA---------- 159

  Fly   240 ADIYTVQLNSAMRASGNLGAAKDSFLNNNNNGQNGAANAPPPNYEAKCYIEHGRINFGKLITDEI 304
                                          ||::...|        |.|::..  :..:::...|
plant   160 ------------------------------NGESRVYN--------KDYVKDQ--DMIQMLIGSI 184

  Fly   305 MSADYKLVEQAKRATNI----AGTTALIAIVQGSKLIVANVGDSRGVM----YDWRGIAIPLSFD 361
            :.|...:.::.|...::    :||||:..:.||..|::.|:||||.|:    .|.:.:...|:.|
plant   185 VKAYRFMDKELKMQVDVDCFCSGTTAVTMVKQGQHLVIGNIGDSRAVLGVRNKDNKLVPFQLTED 249

  Fly   362 HKPQQVRERKRIHDAGGFI-AFR---GVWRV------AGVLATSRALGDYPLKDKNLVIATPDIL 416
            .||....|.:||....|.| |.|   ||.|:      :..||.:||.||:.|||..| |:.||:.
plant   250 LKPDVPAEAERIKRCRGRIFALRDEPGVARLWLPNHNSPGLAMARAFGDFCLKDFGL-ISVPDVS 313

  Fly   417 TFELNDHKPHFLILASDG--------------LWDTFSNEEACTFALEHLKEPDFGAKSLAME-- 465
            ...|.: |..|::||:||              :||..:|||.....   .|.|...:...|:.  
plant   314 YRRLTE-KDEFVVLATDGVRNIQAQCQNKCGLIWDALTNEEVVKIV---AKAPTRSSAGRALVEA 374

  Fly   466 -------SYKRGSVDNITVLVIVFKNDVYKIGSSA 493
                   .:....||:..|:.:...::..::.:::
plant   375 AVRNWRWKFPTSKVDDCAVVCLFLDSEPNRLSTAS 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 95/412 (23%)
PP2C74NP_001330834.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X119
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.860

Return to query results.
Submit another query.