DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and AT5G26010

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_197973.2 Gene:AT5G26010 / 832670 AraportID:AT5G26010 Length:331 Species:Arabidopsis thaliana


Alignment Length:250 Identity:71/250 - (28%)
Similarity:110/250 - (44%) Gaps:59/250 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 HGRIN--FGKLITDEIMSADYKLVEQAKRATNI-------------------------------- 321
            ||:..  ..|::.:.:.|....|.|:..:.:|:                                
plant    80 HGKNGHMVSKMVRNRLPSVLLALKEELNQESNVCEEEASKWEKACFTAFRLIDRELNLQVFNCSF 144

  Fly   322 AGTTALIAIVQGSKLIVANVGDSRGVM----YDWRGIAIPLSFDHKPQQVRERKRIHDAGGFI-- 380
            :|:|.::||.||..|::||:||||.|:    .|....|:.|:.|..|....|.:||....|.:  
plant   145 SGSTGVVAITQGDDLVIANLGDSRAVLGTMTEDGEIKAVQLTSDLTPDVPSEAERIRMCKGRVFA 209

  Fly   381 -----AFRGVW----RVAGVLATSRALGDYPLKDKNLVIATPDILTFELNDHKPHFLILASDGLW 436
                 :.:.||    .:.| ||.|||.||:.|||.. |||.|:|....:.. |..||:||:||:|
plant   210 MKTEPSSQRVWLPNQNIPG-LAMSRAFGDFRLKDHG-VIAVPEISQHRITS-KDQFLVLATDGVW 271

  Fly   437 DTFSNEEACTFALEHLKEPDFGAKSLA-------MESYKRGSVDNITVLVIVFKN 484
            |..||:|..:......|:....||.:|       .:..|...||:|||:.:..:|
plant   272 DMLSNDEVVSLIWSSGKKQASAAKMVAEAAEAAWKKRLKYTKVDDITVICLFLQN 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 70/246 (28%)
AT5G26010NP_197973.2 PP2Cc 42..324 CDD:238083 70/246 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X119
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.860

Return to query results.
Submit another query.