DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and ABI1

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_194338.1 Gene:ABI1 / 828714 AraportID:AT4G26080 Length:434 Species:Arabidopsis thaliana


Alignment Length:477 Identity:118/477 - (24%)
Similarity:175/477 - (36%) Gaps:184/477 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 SRSIL-GRIQA---TLGRQKAVKMMELSASAGDHQSWEEMKQQS---------SAF--------- 114
            ||.:| .||.:   .:....|..::.:..||||..:..::..:.         |.|         
plant    66 SRKVLISRINSPNLNMKESAAADIVVVDISAGDEINGSDITSEKKMISRTESRSLFEFKSVPLYG 130

  Fly   115 --AVLGRRPRMED------RFI-------IEENINNNTGISFFAVFDGHGGEFAADFAKDVLVKN 164
              ::.||||.|||      ||:       ::...:..:...||.|:|||||...|::.::.:...
plant   131 FTSICGRRPEMEDAVSTIPRFLQSSSGSMLDGRFDPQSAAHFFGVYDGHGGSQVANYCRERMHLA 195

  Fly   165 IYNKIIEMSKLLKTEGNSGDYDKSPYLARKQSRKDANKENTEPTAGVMRKDSLRKAHSTTADCSA 229
            :..:|.:...:|        .|...:|                       :..:||         
plant   196 LAEEIAKEKPML--------CDGDTWL-----------------------EKWKKA--------- 220

  Fly   230 IKQKTTEASIADIYTVQLNSAMRASGNLGAAKDSFLNNNNNGQNGAANAPPPNYEAKCYIEHGRI 294
                            ..||.:|                                          
plant   221 ----------------LFNSFLR------------------------------------------ 227

  Fly   295 NFGKLITDEIMSADYKLVEQAKRATNIAGTTALIAIVQGSKLIVANVGDSRGVMYDWRG-IAIPL 358
                 :..||.|.          |....|:|:::|:|..|.:.|||.||||.|:  .|| .|:||
plant   228 -----VDSEIESV----------APETVGSTSVVAVVFPSHIFVANCGDSRAVL--CRGKTALPL 275

  Fly   359 SFDHKPQQVRERKRIHDAGG-FIAFRGVWRVAGVLATSRALGDYPLKDKNLVIATPDILTFELND 422
            |.||||.:..|..||..||| .|.:.|. ||.||||.||::||..||..  :|..|:: |.....
plant   276 SVDHKPDREDEAARIEAAGGKVIQWNGA-RVFGVLAMSRSIGDRYLKPS--IIPDPEV-TAVKRV 336

  Fly   423 HKPHFLILASDGLWDTFSNEEACTFA-----LEHLKEPDFGAKSLAME----------------- 465
            .:...|||||||:||..::||||..|     |.|.|....|..||..:                 
plant   337 KEDDCLILASDGVWDVMTDEEACEMARKRILLWHKKNAVAGDASLLADERRKEGKDPAAMSAAEY 401

  Fly   466 ----SYKRGSVDNITVLVIVFK 483
                :.:|||.|||:|:|:..|
plant   402 LSKLAIQRGSKDNISVVVVDLK 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 107/431 (25%)
ABI1NP_194338.1 PP2Cc 119..420 CDD:214625 106/419 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.