DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and PP2C52

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001190668.1 Gene:PP2C52 / 827930 AraportID:AT4G03415 Length:468 Species:Arabidopsis thaliana


Alignment Length:449 Identity:101/449 - (22%)
Similarity:168/449 - (37%) Gaps:131/449 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 KQQSSA-FAVLGRRPRMEDRFIIEENINNNTGISFFAVFDGHG--GEFAADFAKDVLVKNIYNKI 169
            |.:||. |...||:...:|..|:.|:..:. .::|..||||||  |...|...:|.|.       
plant    64 KSRSSCIFTQQGRKGINQDAMIVWEDFMSE-DVTFCGVFDGHGPYGHLVARKVRDTLP------- 120

  Fly   170 IEMSKLLKTEGNSGDYDKSPYLARKQSRKDANKENTEPTAGVMRKDSLRKAHSTTADCSAIKQKT 234
            :::....:|               .||:::.:|..           ..|:..|.:|...|:|:.:
plant   121 VKLQFFFQT---------------LQSKQNCSKGT-----------RFRRNSSKSAVQEAVKEGS 159

  Fly   235 TEASIADIYTVQLNSAMRASGNLGAAKDSFLNNNNNGQNGAANAPPPNYEAKCYIEHGRINFGKL 299
            .|..:..::......:.:       |.|..|.::            ||.:..|            
plant   160 DEDKLKGLWGEAFLKSFK-------AMDKELRSH------------PNLDCFC------------ 193

  Fly   300 ITDEIMSADYKLVEQAKRATNIAGTTALIAIVQGSKLIVANVGDSRGVMYDWRG--------IAI 356
                                  :|:|.:..:.|||.|.:.|:||||.::    |        :|.
plant   194 ----------------------SGSTGVTILKQGSNLFMGNIGDSRAIL----GSKDSNDSMVAT 232

  Fly   357 PLSFDHKPQQVRERKRIHDAGGFI-------AFRGVWRV---AGVLATSRALGDYPLKDKNLVIA 411
            .|:.|.||...||.:||....|.:       ....||..   |..||.:||.||:.||:.. ||:
plant   233 QLTVDLKPDLPREAERIKRCKGRVFAMEDEPEVPRVWLPYDDAPGLAMARAFGDFCLKEYG-VIS 296

  Fly   412 TPDILTFELNDHKPHFLILASDGLWDTFSNEEACTFALEHLKEPDFG---AKSLAME---SYKRG 470
            .|:.....|.| :..|::|||||:||..||||...............   ..|.|.|   .|...
plant   297 VPEFTHRVLTD-RDQFIVLASDGVWDVLSNEEVVDIVASATSRASAARTLVNSAAREWKLKYPTS 360

  Fly   471 SVDNITVLVIVF------KNDVYKIGSSAGKAGEESLKVPAKSQPVAPAVVQRSNSIKT 523
            .:|:..|:.:..      ::|..:.|.|:.....|| ....:|:|    .:||:.::::
plant   361 KMDDCAVVCLFLDGKMDSESDYDEQGFSSATNAVES-DDGQRSEP----CLQRNFTVRS 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 91/397 (23%)
PP2C52NP_001190668.1 PP2Cc 73..372 CDD:238083 88/391 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X119
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.860

Return to query results.
Submit another query.