DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and AT4G16580

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_193391.3 Gene:AT4G16580 / 827359 AraportID:AT4G16580 Length:467 Species:Arabidopsis thaliana


Alignment Length:337 Identity:63/337 - (18%)
Similarity:104/337 - (30%) Gaps:142/337 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 VQLNSAMRASGNLGAAKDSFLNNNNNGQNGAANAPPPNYE------------------------- 284
            :.||...|..|..|      |:::.:.:..|.|||..:.:                         
plant   159 IYLNQQRRGMGFRG------LHSSLSNRLSAGNAPDVSLDNSVTDEQVRDSSDSVAAKLCTKPLK 217

  Fly   285 ---AKCYIEH-------------------------GRINFGKLITD------EIMSADY------ 309
               ..||:.|                         |...:.:|..|      |:||...      
plant   218 LVSGSCYLPHPDKEATGGEDAHFICAEEQALGVADGVGGWAELGIDAGYYSRELMSNSVNAIQDE 282

  Fly   310 --------KLVEQAKRATNIAG-TTALIAIVQGSKLIVANVGDSRGVMYDWRGIAIPLSFDHKPQ 365
                    :::|:|...|...| :||.|..:....|...|:||| |.|....|..:   |....|
plant   283 PKGSIDPARVLEKAHTCTKSQGSSTACIIALTNQGLHAINLGDS-GFMVVREGHTV---FRSPVQ 343

  Fly   366 QVRERKRIHDAGGFIAFRGVWRVAGVLATSRALGDYPLKDK--NLVIATPDILTFELNDHKPHFL 428
            |       ||      |...:::     .|...||.|...:  .:.:|..|:            :
plant   344 Q-------HD------FNFTYQL-----ESGRNGDLPSSGQVFTVAVAPGDV------------I 378

  Fly   429 ILASDGLWDTFSNEEACTFALEHLK---EPDFGAKSLAMESYKR--------------------- 469
            |..:|||:|...|.|.....:..::   :|...|:.:|..:.:|                     
plant   379 IAGTDGLFDNLYNNEITAIVVHAVRANIDPQVTAQKIAALARQRAQDKNRQTPFSTAAQDAGFRY 443

  Fly   470 --GSVDNITVLV 479
              |.:|:|||:|
plant   444 YGGKLDDITVVV 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 63/337 (19%)
AT4G16580NP_193391.3 PP2Cc 235..455 CDD:412173 49/253 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.