DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and AT4G11040

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_192842.1 Gene:AT4G11040 / 826705 AraportID:AT4G11040 Length:295 Species:Arabidopsis thaliana


Alignment Length:248 Identity:57/248 - (22%)
Similarity:93/248 - (37%) Gaps:103/248 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 PNYE----------AKCYIEHGRINFGKLITDEI-------MSADYKLVEQA--KRATNIAGTT- 325
            |:|:          ||.:.:..|    :|:.:|:       ::||:..|.::  ..|....||| 
plant   103 PSYDIFGIFDGLRLAKFFEDRLR----RLVKEEVKACHGRGVAADWNKVMKSCFSEAVGTVGTTT 163

  Fly   326 -ALIAIVQGSKLIVANVGDSRGVMYDWRGIAIPLSFDHKPQ-------QVRERKRIHDAGGFIAF 382
             |::.||...::||...|.:|.|:|...|:|:||...|..:       ::.:||:|.|       
plant   164 SAVVTIVGKEEVIVLCRGGARVVLYSHDGVALPLCHIHHHKDGVEQILKIHKRKKIDD------- 221

  Fly   383 RGVWRVAGVLATSRALGDYPLKDKNLVIATPDILTFELNDHKPHFLILASDGLWDTFSNEEA--- 444
                                                        |::||.|||||..|:::.   
plant   222 --------------------------------------------FIVLACDGLWDVVSDDDTYQL 242

  Fly   445 ---CTFALEHLKEPDFGAKS----------LAMESYKRGSVDNITVLVIVFKN 484
               |.:.    |.|..|..|          ||..:..|||.:||.|:||..|:
plant   243 VKRCLYG----KLPPDGCISESSSTKAAVILAELAIARGSKENINVIVIDLKS 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 56/244 (23%)
AT4G11040NP_192842.1 PP2Cc 79..287 CDD:214625 54/242 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.