DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and AT4G08260

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_192566.1 Gene:AT4G08260 / 826376 AraportID:AT4G08260 Length:212 Species:Arabidopsis thaliana


Alignment Length:369 Identity:83/369 - (22%)
Similarity:116/369 - (31%) Gaps:162/369 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 MEDRFIIEENINNNTGISFFAVFDGHGGEFAADFAKDVLVKNIYNKIIEMSKLLKTEGNSGDYDK 187
            |||||....|::.:...:.|.|:.||||..||:||...|.|||..:::: :..||.||..|    
plant     1 MEDRFSAITNLHGDHKQAIFGVYVGHGGVKAAEFAAKNLDKNIVEEVVD-ATFLKEEGFKG---- 60

  Fly   188 SPYLARKQSRKDANKENTEPTAGVMRKDSLRKAHSTTADCSAIKQKTTEASIADIYTVQLNSAMR 252
                                                                             
plant    61 ----------------------------------------------------------------- 60

  Fly   253 ASGNLGAAKDSFLNNNNNGQNGAANAPPPNYEAKCYIEHGRINFGKLITDEIMSADYKLVEQAKR 317
                                                                             
plant    61 ----------------------------------------------------------------- 60

  Fly   318 ATNIAGTTALIAIVQGSKLIVANVGDSRGVMYDWRGIAIPLSFDHKPQQVRERKRIHDAGGFIAF 382
                 |::.:.|:|....|:|:|.||.|.||      ::....:.|..:.||...|...      
plant    61 -----GSSCVTALVSEGSLVVSNAGDCRAVM------SVGEMMNGKELKPREDMLIRFT------ 108

  Fly   383 RGVWRVAGVLATSRALGDYPLKDKNLVIATPDILTFELNDHKPHFLILASDGLWDTFSNEEAC-- 445
              :||:.|.|...|.:||..|  |..|||.|:.....: :|...||||||.||||..||:||.  
plant   109 --LWRIQGSLVVPRGIGDAQL--KKWVIAEPETKISRV-EHDHEFLILASHGLWDKVSNQEAVDI 168

  Fly   446 --TFALEHLKEPDFGA-KSLAMESYKRGSVDNITVLVIVFKNDV 486
              .|.|...|.....| |.|...|..|||.|:|:|::|..:..|
plant   169 ARPFCLRTEKPLLLAACKKLVDLSASRGSFDDISVMLIPLRQFV 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 82/363 (23%)
AT4G08260NP_192566.1 PP2Cc 1..208 CDD:238083 82/363 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 45 1.000 Domainoid score I4631
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.