DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and AT3G55050

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_191065.2 Gene:AT3G55050 / 824671 AraportID:AT3G55050 Length:384 Species:Arabidopsis thaliana


Alignment Length:349 Identity:92/349 - (26%)
Similarity:138/349 - (39%) Gaps:99/349 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 KDANKENT-EPTAGVMRKDSLRKAHS-TTADCSAIKQKTTEASIADIYTVQLNSAMRASGNLGAA 260
            ||:....| |.:..|::.::|.:.|| ..:...::.:...||:...:|          .|:.|..
plant    41 KDSGNHITGEFSMAVVQANNLLEDHSQLESGPISLHESGPEATFVGVY----------DGHGGPE 95

  Fly   261 KDSFLNNNNNGQNGAANAPPPNYEAKCYIEHGRINFGKLITDEIMSADYKLV----EQAKRATNI 321
            ...|:|:.            ..|..|.|....|.....:||...::.:.:.:    ||.|....|
plant    96 AARFVNDR------------LFYNIKRYTSEQRGMSPDVITRGFVATEEEFLGLVQEQWKTKPQI 148

  Fly   322 A--GTTALIAIVQGSKLIVANVGDSRGVM----YDWRGI-AIPLSFDHKP--QQVRERKRI---H 374
            |  |...|:.||....|.|||.||||.|:    ..::.: |:.||.:|..  :.|||..|:   .
plant   149 ASVGACCLVGIVCNGLLYVANAGDSRVVLGKVANPFKELKAVQLSTEHNASIESVREELRLLHPD 213

  Fly   375 DAGGFIAFRGVWRVAGVLATSRALGDYPLK-------------------DKNLVIATPDILTFEL 420
            |....:....||||.|::..||::||..||                   :|.::.|.|.|..   
plant   214 DPNIVVLKHKVWRVKGIIQVSRSIGDAYLKRAEFNQEPLLPKFRVPERFEKPIMRAEPTITV--- 275

  Fly   421 NDHKPH----FLILASDGLWDTFSNEEACTF----------------ALEHLKEPDFGAKSLAM- 464
              ||.|    |||.||||||:..||:||...                ||:.      .||...| 
plant   276 --HKIHPEDQFLIFASDGLWEHLSNQEAVDIVNSCPRNGVARKLVKAALQE------AAKKREMR 332

  Fly   465 ----ESYKRG----SVDNITVLVI 480
                |..:||    ..|:|||:|:
plant   333 YSDLEKIERGIRRHFHDDITVIVV 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 92/349 (26%)
AT3G55050NP_191065.2 PP2Cc 51..358 CDD:238083 88/339 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.