DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and AT3G27140

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_189350.2 Gene:AT3G27140 / 822333 AraportID:AT3G27140 Length:245 Species:Arabidopsis thaliana


Alignment Length:206 Identity:61/206 - (29%)
Similarity:83/206 - (40%) Gaps:55/206 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 YIEHGRI--------NFGKLITDEIMSADYKLVEQAKRATNIAGTTALIAIVQGSKLIVANVGDS 344
            |:.||.:        |..|.|.:|::...::|     ......|::.:.|:|....|:|:|.||.
plant    23 YVGHGGVKAAECPAKNLDKNIVEEVVGKRHEL-----EIAEAGGSSCVTALVSEGSLVVSNAGDC 82

  Fly   345 RGVMYDWRGIAIPLSFDHKPQQVRERKRIHDAGGFIAFRGVWRVAGVLATSRALGDYPLKDKNLV 409
            |.||                          ..||.        ..|.|...|.:||..|  |..|
plant    83 RAVM--------------------------SVGGV--------AKGSLVVPRGIGDAQL--KKWV 111

  Fly   410 IATPDILTFELNDHKPHFLILASDGLWDTFSNEEAC----TFALEHLKEPDFGA-KSLAMESYKR 469
            ||.|:.....: :|...||||||.||||..||:||.    .|.|...|.....| |.|...|..|
plant   112 IAEPETKISRV-EHDHEFLILASHGLWDKVSNQEAVDIARPFCLRTEKPLLLAACKKLVDLSASR 175

  Fly   470 GSVDNITVLVI 480
            ||.|:|:|::|
plant   176 GSFDDISVMLI 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 61/206 (30%)
AT3G27140NP_189350.2 PP2Cc 1..188 CDD:238083 61/206 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 45 1.000 Domainoid score I4631
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.