DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and AT3G16800

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001319572.1 Gene:AT3G16800 / 820933 AraportID:AT3G16800 Length:351 Species:Arabidopsis thaliana


Alignment Length:432 Identity:109/432 - (25%)
Similarity:166/432 - (38%) Gaps:144/432 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 GRQKAVKMME-------LSASAGDHQSWEEMKQQSSAFAVLGRRPRMEDRFIIEENINNNTGISF 141
            ||:.|..|::       |..::| ..|.|..|:.:|..:..|.:...:||.|:.|.......|:|
plant    30 GREIAKSMIKDSKKNSTLLGTSG-FVSSESSKRFTSICSNRGEKGINQDRAIVWEGFGCQEDITF 93

  Fly   142 FAVFDGHG--GEFAADFAKDVLVKNIYNKIIEMSKLLKTEGNSGDYDKSPYLARKQSRKDANKEN 204
            ..:|||||  |.        |:.|.: .|....|.|.:.:........||               
plant    94 CGMFDGHGPWGH--------VIAKRV-KKSFPSSLLCQWQQTLASLSSSP--------------- 134

  Fly   205 TEPTAGVMRKDSLRKAHSTTADCSAIKQKTTEASIADIYTVQLNSAMRASGNLGAAKDSFLNNNN 269
                                 :||:......:|.:.....:.|:  ::.|               
plant   135 ---------------------ECSSPFDLWKQACLKTFSIIDLD--LKIS--------------- 161

  Fly   270 NGQNGAANAPPPNYEAKCYIEHGRINFGKLITDEIMSADYKLVEQAKRATNIAGTTALIAIVQGS 334
                       |:.::.|                                  :|.|||.|::||.
plant   162 -----------PSIDSYC----------------------------------SGCTALTAVLQGD 181

  Fly   335 KLIVANVGDSRGVMY----DWRG-IAIPLSFDHKPQQVRERKRIHDAGGFIAF----RGVWRVAG 390
            .|::||.||||.|:.    |..| :.:.||.|.||....|.:||..:.|.:..    .||:|| |
plant   182 HLVIANAGDSRAVIATTSDDGNGLVPVQLSVDFKPNIPEEAERIKQSDGRLFCLDDEPGVYRV-G 245

  Fly   391 V-------LATSRALGDYPLKDKNLVIATPDILTFELNDHKPHFLILASDGLWDTFSNEEACTFA 448
            :       ||.|||.|||.|||..|| :.|::...::.| |..|||||:||:||..:|.||... 
plant   246 MPNGGSLGLAVSRAFGDYCLKDFGLV-SEPEVTYRKITD-KDQFLILATDGMWDVMTNNEAVEI- 307

  Fly   449 LEHLKEPDFGAKSLAMESY-----KRGSV--DNITVLVIVFK 483
            :..:||....||.|...:.     ||.|:  |:|:||.:.|:
plant   308 VRGVKERRKSAKRLVERAVTLWRRKRRSIAMDDISVLCLFFR 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 99/395 (25%)
AT3G16800NP_001319572.1 PP2Cc 61..348 CDD:238083 99/397 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X119
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.