DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and AT3G06270

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_187278.2 Gene:AT3G06270 / 819801 AraportID:AT3G06270 Length:348 Species:Arabidopsis thaliana


Alignment Length:419 Identity:88/419 - (21%)
Similarity:147/419 - (35%) Gaps:177/419 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 FAVLGRR------PRME--DRFIIEENINNNTGISFFAVFDGHG--GEFAADFAKDVLVKNIYNK 168
            ::||.:|      |..|  |.:.|:..:..|..:.||.||||||  |...::|.|:        :
plant    53 YSVLSQRGYYPDSPDKENQDTYCIKTELQGNPNVHFFGVFDGHGVLGTQCSNFVKE--------R 109

  Fly   169 IIEMSKLLKTEGNSGDYDKSPYLARKQSRKDANKENTEPTAGVMRKDSLRKAHSTTADCSAIKQK 233
            ::||            ..:.|.|.     :|..|                               
plant   110 VVEM------------LSEDPTLL-----EDPEK------------------------------- 126

  Fly   234 TTEASIADIYTVQLNSAMRASGNLGAAKDSFLNNNNNGQNGAANAPPPNYEAKCYIEHGRINFGK 298
                                     |.|.:||                           |:|   
plant   127 -------------------------AYKSAFL---------------------------RVN--- 136

  Fly   299 LITDEIMSADYKLVEQAKRATNIAGTTALIAIVQGSKLIVANVGDSRGVMY---DWRGIAIPLSF 360
               :|:..::..        .:::||||:..:|.|.|:.||||||||.|:.   ..|.:|..||:
plant   137 ---EELHDSEID--------DSMSGTTAITVLVVGDKIYVANVGDSRAVLAVKDRNRILAEDLSY 190

  Fly   361 DHKPQQVRERKRIHDAGGFIAFRGVWRVAGV------------------------------LATS 395
            |..|.:..|.:|:...|..:.  .|.:|.|:                              .|.:
plant   191 DQTPFRKDECERVKACGARVL--SVDQVEGLKDPNIQTWANEESEGGDPPRLWVQNGMYPGTAFT 253

  Fly   396 RALGDYPLKDKNLVIATPDILTFELNDHKPH-FLILASDGLWDTFSNEEACTFALEHLKEPDFGA 459
            |::||:..:... |||.|::....|:.:  | |.::||||::: |...:|....:....:|..|.
plant   254 RSVGDFTAESIG-VIAEPEVSMVHLSPN--HLFFVVASDGIFE-FLPSQAVVDMVGRYADPRDGC 314

  Fly   460 KSLAMESYK-----RGSVDNITVLVIVFK 483
            .:.|.||||     ....|:||::::..|
plant   315 AAAAAESYKLWLEHENRTDDITIIIVQIK 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 87/416 (21%)
AT3G06270NP_187278.2 PP2Cc 68..342 CDD:238083 83/401 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.860

Return to query results.
Submit another query.