DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and PP2C5

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_181547.1 Gene:PP2C5 / 818609 AraportID:AT2G40180 Length:390 Species:Arabidopsis thaliana


Alignment Length:434 Identity:118/434 - (27%)
Similarity:171/434 - (39%) Gaps:152/434 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 GRIQATLGRQKAVKMMELSASAGDHQSWEEMKQQS----------------SAFAVLGRRPRMED 125
            |....|:.::|...|::|:| |....||....:::                |.:...|||..|||
plant    80 GSDSETVLKRKRPPMLDLTA-APTVASWCSTTRETAEKGAEVVEAEEDGYYSVYCKRGRRGPMED 143

  Fly   126 RFIIEENINNNTGI--SFFAVFDGHGGEFAADFAKDVLVKNIYNKIIEMSKLLKTEGNSGDYDKS 188
            |:....:.|::.|.  :||.|||||||..||:||                               
plant   144 RYFAAVDRNDDGGYKNAFFGVFDGHGGSKAAEFA------------------------------- 177

  Fly   189 PYLARKQSRKDANKENTEPTAGVMRKDSLRKAHSTTADCSAIKQKTTEASIADIYTVQLNSAMRA 253
                                                                         ||..
plant   178 -------------------------------------------------------------AMNL 181

  Fly   254 SGNLGAAKDSFLNNNNNGQNGAANAPPPNYEAKCYIEHGRINFGKLITDEIMSADYKLVEQAKRA 318
            ..|:.||    :.:..:|::|            |.:| ..|..|.:.|||    |:  :::..| 
plant   182 GNNIEAA----MASARSGEDG------------CSME-SAIREGYIKTDE----DF--LKEGSR- 222

  Fly   319 TNIAGTTALIAIVQGSKLIVANVGDSRGVMYDWRGIAIPLSFDHKPQQVRERKRIHDAGGFI-AF 382
               .|...:.|::...:|.|:|.||.|.|| ...|.|..|:.||.|.|..|.|||...||:: ..
plant   223 ---GGACCVTALISKGELAVSNAGDCRAVM-SRGGTAEALTSDHNPSQANELKRIEALGGYVDCC 283

  Fly   383 RGVWRVAGVLATSRALGDYPLKDKNLVIATPDILTFELNDHKP--HFLILASDGLWDTFSNEEAC 445
            .||||:.|.||.||.:||..||:  .|||.|:..|..:   ||  .|||||||||||..:|:||.
plant   284 NGVWRIQGTLAVSRGIGDRYLKE--WVIAEPETRTLRI---KPEFEFLILASDGLWDKVTNQEAV 343

  Fly   446 TFALEH---LKEPD--FGAKSLAMESYKRGSVDNITVLVIVFKN 484
            .....:   ::.|.  ...|.||..|.||||:|:|::::|..:|
plant   344 DVVRPYCVGVENPMTLSACKKLAELSVKRGSLDDISLIIIQLQN 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 108/396 (27%)
PP2C5NP_181547.1 PP2Cc 128..385 CDD:238083 108/381 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 149 1.000 Domainoid score I1420
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3531
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.