DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and AT2G34740

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_181021.4 Gene:AT2G34740 / 818039 AraportID:AT2G34740 Length:339 Species:Arabidopsis thaliana


Alignment Length:366 Identity:89/366 - (24%)
Similarity:141/366 - (38%) Gaps:138/366 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 MEDRFIIEENINNNTGISFFAVFDGHGGEFAADFAKDVLVKNIYNKIIEMSKLLKTEGNSGDYDK 187
            |||..:.:........:..:|:||||.|...||:.::.|..||.::              .|:.:
plant   101 MEDFIVADTKTVKGHNLGLYAIFDGHSGSDVADYLQNHLFDNILSQ--------------PDFWR 151

  Fly   188 SPYLARKQSRKDANKENTEPTAGVMRKDSLRKAHSTTADCSAIKQKTTEASIADIYTVQLNSAMR 252
            :|                        |.::::|:.:|                            
plant   152 NP------------------------KKAIKRAYKST---------------------------- 164

  Fly   253 ASGNLGAAKDSFLNNNNNGQNGAANAPPPNYEAKCYIEHGRINFGKLITDEIMSADYKLVEQAKR 317
                     |.::..|..|..|                                           
plant   165 ---------DDYILQNVVGPRG------------------------------------------- 177

  Fly   318 ATNIAGTTALIAIV-QGSKLIVANVGDSRGVMYDWRGIAIPLSFDHKPQQVRERKRIHDAGGFIA 381
                 |:||:.||| .|.|::||||||||.::.....:...::.||:|.  :||..:...|||::
plant   178 -----GSTAVTAIVIDGKKIVVANVGDSRAILCRESDVVKQITVDHEPD--KERDLVKSKGGFVS 235

  Fly   382 FR--GVWRVAGVLATSRALGDYPLKDKNLVIATPDILTFELNDHKPHFLILASDGLWDTFSNEEA 444
            .:  .|.||.|.||.:||.||..||:...||  |:|...|::| ...||||||||||...||:| 
plant   236 QKPGNVPRVDGQLAMTRAFGDGGLKEHISVI--PNIEIAEIHD-DTKFLILASDGLWKVMSNDE- 296

  Fly   445 CTFALEHLKE---PDFGAKSLAMESYKRGSVDNITVLVIVF 482
               ..:.:|:   .:..||.|..::..|||.|:|:.:|:.|
plant   297 ---VWDQIKKRGNAEEAAKMLIDKALARGSKDDISCVVVSF 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 88/364 (24%)
AT2G34740NP_181021.4 PP2Cc 86..334 CDD:238083 88/364 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X119
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.