DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and PBCP

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_565696.1 Gene:PBCP / 817569 AraportID:AT2G30170 Length:298 Species:Arabidopsis thaliana


Alignment Length:320 Identity:59/320 - (18%)
Similarity:118/320 - (36%) Gaps:99/320 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 SLRKAHSTTA------DC--SAIKQKTTEASIA-DIYTVQLNSAMRASGNLGAAKDSFLNNNNNG 271
            |||.:|...:      .|  |.|:....|.|:: .|:.:.....:...|     :|:|..::..|
plant    16 SLRLSHPNPSRVDFLCRCAPSEIQPLRPELSLSVGIHAIPHPDKVEKGG-----EDAFFVSSYRG 75

  Fly   272 -----QNGAANAPPPNYEAKCYIEHGRINFGKLITDEIMSADYK-LVEQAKRATNIAGT-TALIA 329
                 .:|.:.....:.:...:.:....|..:|:.|:.:..|.. |:::|..||...|: |.::|
plant    76 GVMAVADGVSGWAEQDVDPSLFSKELMANASRLVDDQEVRYDPGFLIDKAHTATTSRGSATIILA 140

  Fly   330 IVQGSKLI-VANVGDSRGVMYDWRGIAIPLSFDHKPQQVRERKRIHDAGGFIAFRGVWRVAGVLA 393
            :::...:: :.||||.        |:.:          :||        |.|.|        ..|
plant   141 MLEEVGILKIGNVGDC--------GLKL----------LRE--------GQIIF--------ATA 171

  Fly   394 TSRALGDYPLK------DKNLVIATPDILTFELNDHKPHFLILASDGLWDTFSNEEACTF----- 447
            ......|.|.:      .:..:.|:..|:..:..|    .:::.||||:|...:.|..:.     
plant   172 PQEHYFDCPYQLSSEGSAQTYLDASFSIVEVQKGD----VIVMGSDGLFDNVFDHEIVSIVTKHT 232

  Fly   448 ------------ALEHLKEPDF--------GAKSLAMESYKR--------GSVDNITVLV 479
                        |..|.::.:|        .||...:..:|:        |.:|::||:|
plant   233 DVAESSRLLAEVASSHSRDTEFESPYALEARAKGFDVPLWKKVLGKKLTGGKLDDVTVIV 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 59/320 (18%)
PBCPNP_565696.1 PP2Cc 39..251 CDD:214625 43/254 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.