DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and PLL4

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_180455.1 Gene:PLL4 / 817438 AraportID:AT2G28890 Length:654 Species:Arabidopsis thaliana


Alignment Length:466 Identity:103/466 - (22%)
Similarity:158/466 - (33%) Gaps:175/466 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 EDRFIIEENINNNTGISFFAVFDGHGGEFAADFAKDVLVKNIYNKI-IEMSKLL----KTEGNSG 183
            |||  :...::...|..|..::||..|..|.|:    |:.::|..: .|:..||    ||:..|.
plant   260 EDR--VHVVVSEEHGWLFVGIYDGFNGPDAPDY----LLSHLYPAVHRELKGLLWDDPKTDAKSS 318

  Fly   184 DYDKSPYLARKQSRKDANKENTEPTAGVMRKDSLRKAHSTTADCSAIKQKTTEASIADIYTVQLN 248
            |              :|:.||         :||          .|..|.|..|           .
plant   319 D--------------EADVEN---------RDS----------SSEKKSKNWE-----------E 339

  Fly   249 SAMRASGNLGAAKDSFLNNNNNGQNGAANAPPPNYE-------------AKCYIEHGRINFGKLI 300
            |..|.........|..|.:.:||.:   ..|.||..             .:.|:|          
plant   340 SQRRWRCEWDRDLDRLLKDRSNGLD---LDPDPNSSDVLKALSQALRKTEEAYLE---------- 391

  Fly   301 TDEIMSADYKLVEQAKRATNIAGTTALIAIVQGSKLIVANVGDSRGV------------------ 347
                 :||..|.|..:.|  :.|:..|:.:::|..:.:.||||||.|                  
plant   392 -----NADMMLDENPELA--LMGSCVLVMLMKGEDVYLMNVGDSRAVLGQKAESDYWIGKIKQDL 449

  Fly   348 -------MYDWRGI-------------AIPLSFDHKPQQVRERKRIH----DAGGFIAFRGVWRV 388
                   |.|:.|.             |..|:.||......|..||.    |....::..   ||
plant   450 ERINEETMNDFDGCGDGEGASLVPTLSAFQLTVDHSTNVEEEVNRIRKEHPDDASAVSNE---RV 511

  Fly   389 AGVLATSRALGDYPLKD---KNLVI---------------ATPDILTFELNDHKPHFLILASDGL 435
            .|.|..:||.|...||.   .|.::               ..|.:....|.. |..||||:||||
plant   512 KGSLKVTRAFGAGFLKQPKWNNALLEMFQIDYKGTSPYINCLPSLYHHRLGS-KDQFLILSSDGL 575

  Fly   436 WDTFSNEEACTFA------------LEHL-KEPDF-GAKSLAMESY---------KRGSVDNITV 477
            :..|:||||.:..            .:|| :|..| .||...|:.:         :|...|::::
plant   576 YQYFTNEEAVSEVELFITLQPEGDPAQHLVQELLFRAAKKAGMDFHELLEIPQGERRRYHDDVSI 640

  Fly   478 LVIVFKNDVYK 488
            :||..:..::|
plant   641 VVISLEGRMWK 651

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 102/458 (22%)
PLL4NP_180455.1 PP2Cc 257..645 CDD:238083 102/458 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.