DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and DBP1

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001324148.1 Gene:DBP1 / 817102 AraportID:AT2G25620 Length:392 Species:Arabidopsis thaliana


Alignment Length:446 Identity:113/446 - (25%)
Similarity:174/446 - (39%) Gaps:155/446 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LYLQAVDVWSRSILGRIQATLGRQKA-VKMMELSASAGDHQSWEEMKQQ------SSAFAVLGRR 120
            :|.|..| ..||:....:.:|.|..: ||.|....|..:..:.|:.|.:      |.|::.:|.|
plant    36 VYRQTFD-GERSLAPCNKRSLVRHSSLVKTMVSDISVENEFTIEKNKSEFVPATRSGAWSDIGSR 99

  Fly   121 PRMEDRFIIEENINNNTGI--------SFFAVFDGHGGEFAADFAKDVLVKNIYNKIIEMSKLLK 177
            ..|||.::..:|..::.|:        :|:.|||||||:.||:||                    
plant   100 SSMEDAYLCVDNFMDSFGLLNSEAGPSAFYGVFDGHGGKHAAEFA-------------------- 144

  Fly   178 TEGNSGDYDKSPYLARKQSRKDANKENTEPTAGVMRKDSLRKAHSTTADCSAIKQKTTEASIADI 242
                                                             |..|            
plant   145 -------------------------------------------------CHHI------------ 148

  Fly   243 YTVQLNSAMRASGNLGAAKDSFLNNNNNGQNGAANAPPPNYEAKCYIEHGRINFGKLITDEIMSA 307
                                                  |.|..:.......||  |:::...:..
plant   149 --------------------------------------PRYIVEDQEFPSEIN--KVLSSAFLQT 173

  Fly   308 DYKLVEQAKRATNIA-GTTALIAIVQGSKLIVANVGDSRGVMYDWRGIAIPLSFDHKPQQVRERK 371
            |...:|......::| |||||.||:.|..|:|||.||.|.|: ..:|.||.:|.||||...:||:
plant   174 DTAFLEACSLDGSLASGTTALAAILFGRSLVVANAGDCRAVL-SRQGKAIEMSRDHKPMSSKERR 237

  Fly   372 RIHDAGGFIAFRGVWRVAGVLATSRALGDYPLK---------DKNLVIATPDILTFELNDHKPHF 427
            ||..:||.: |.|.  :.|.|..:|||||:.::         |...:||.|:::|.:|.: :..|
plant   238 RIEASGGHV-FDGY--LNGQLNVARALGDFHMEGMKKKKDGSDCGPLIAEPELMTTKLTE-EDEF 298

  Fly   428 LILASDGLWDTFSNEEACTFALEHLKE---PDFGAKSLAMESYKRGSVDNITVLVI 480
            ||:..||:||.|.::.|..||...|:|   |...:|.|..|:.||.|.||:|.:|:
plant   299 LIIGCDGVWDVFMSQNAVDFARRRLQEHNDPVMCSKELVEEALKRKSADNVTAVVV 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 100/391 (26%)
DBP1NP_001324148.1 PLN03145 3..392 CDD:215603 113/446 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.