DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and PIA1

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_973490.1 Gene:PIA1 / 816590 AraportID:AT2G20630 Length:290 Species:Arabidopsis thaliana


Alignment Length:363 Identity:98/363 - (26%)
Similarity:142/363 - (39%) Gaps:132/363 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 MEDRFIIEENINNNTGISFFAVFDGHGGEFAADFAKDVLVKNIYNKIIEMSKLLKTEGNSGDYDK 187
            |||..:.|....:...:..||:||||.|.   |.|| .|..|:::.|                  
plant    45 MEDYVVSEFKKVDGHDLGLFAIFDGHLGH---DVAK-YLQTNLFDNI------------------ 87

  Fly   188 SPYLARKQSRKDANKENTEPTAGVMRKDSLRKAHSTTADCSAIKQKTTEASIADIYTVQLNSAMR 252
                                                      :|:|       |.:|        
plant    88 ------------------------------------------LKEK-------DFWT-------- 95

  Fly   253 ASGNLGAAKDSFLNNNNNGQNGAANAPPPNYEAKCYIEHGRINFGKLITDEIMSADYKLVEQAKR 317
                             :.:|...||         ||                |.|..::||:.:
plant    96 -----------------DTKNAIRNA---------YI----------------STDAVILEQSLK 118

  Fly   318 ATNIAGTTALIAI-VQGSKLIVANVGDSRGVMYDWRGIAIPLSFDHKPQQVRERKRIHDAGGFIA 381
            ... .|:||:..| :.|..|::|||||||.|| ...|:|..||.||:|.  :|:|.|...|||::
plant   119 LGK-GGSTAVTGILIDGKTLVIANVGDSRAVM-SKNGVASQLSVDHEPS--KEQKEIESRGGFVS 179

  Fly   382 -FRG-VWRVAGVLATSRALGDYPLKDKNLVIATPDILTFELNDHKPHFLILASDGLWDTFSNEEA 444
             ..| |.||.|.||.:||.||..||..  :.:.|||.. |..||:..|::.||||:|...||:||
plant   180 NIPGDVPRVDGQLAVARAFGDKSLKIH--LSSDPDIRD-ENIDHETEFILFASDGVWKVMSNQEA 241

  Fly   445 CTFALEHLKEPDFGAKSLAMESYKRGSVDNITVLVIVF 482
            ... ::.:|:|...||.|..|:..:.|.|:|:.:|..|
plant   242 VDL-IKSIKDPQAAAKELIEEAVSKQSTDDISCIVPCF 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 97/361 (27%)
PIA1NP_973490.1 PP2Cc 43..278 CDD:238083 97/361 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 149 1.000 Domainoid score I1420
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3531
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X119
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.780

Return to query results.
Submit another query.