DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and ILKAP

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_110395.1 Gene:ILKAP / 80895 HGNCID:15566 Length:392 Species:Homo sapiens


Alignment Length:398 Identity:99/398 - (24%)
Similarity:142/398 - (35%) Gaps:160/398 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 GRRPRMEDRFIIEENINNN--------TGISFFAVFDGHGGEFAADFAKDVLVKNIYNK-----I 169
            |.|..|:|..:|..:|...        |.:|:|||||||||..|:.||...|.:|:..|     :
Human   116 GEREEMQDAHVILNDITEECRPPSSLITRVSYFAVFDGHGGIRASKFAAQNLHQNLIRKFPKGDV 180

  Fly   170 IEMSKLLKTEGNSGDYDKSPYLARKQSRKDANKENTEPTAGVMRKDSLRKAHSTTADCSAIKQKT 234
            |.:.|.:                 |:...|..|...|                     ..:||  
Human   181 ISVEKTV-----------------KRCLLDTFKHTDE---------------------EFLKQ-- 205

  Fly   235 TEASIADIYTVQLNSAMRASGNLGAAKDSFLNNNNNGQNGAANAPPPNYEAKCYIEHGRINFGKL 299
                              ||....|.||                                     
Human   206 ------------------ASSQKPAWKD------------------------------------- 215

  Fly   300 ITDEIMSADYKLVEQAKRATNIAGTTALIAIVQGSKLIVANVGDSRGVMYDW-----RGIAIPLS 359
                                   |:||...:...:.|.:||:||||.::..:     :..|:.||
Human   216 -----------------------GSTATCVLAVDNILYIANLGDSRAILCRYNEESQKHAALSLS 257

  Fly   360 FDHKPQQVRERKRIHDAGGFIAFRGVWRVAGVLATSRALGDYPLKDKNLVIATPDILTFEL--ND 422
            .:|.|.|..||.||..|||.:.   ..||.|||..||::||...| :..|.:.|||...:|  ||
Human   258 KEHNPTQYEERMRIQKAGGNVR---DGRVLGVLEVSRSIGDGQYK-RCGVTSVPDIRRCQLTPND 318

  Fly   423 HKPHFLILASDGLWDTFSNEEACTFALEHLKEP---------------DFGAKSLAMESYKRGSV 472
               .|::||.|||:..|:.|||..|.|..|::.               :.....||.::.:|||.
Human   319 ---RFILLACDGLFKVFTPEEAVNFILSCLEDEKIQTREGKSAADARYEAACNRLANKAVQRGSA 380

  Fly   473 DNITVLVI 480
            ||:||:|:
Human   381 DNVTVMVV 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 99/398 (25%)
ILKAPNP_110395.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..90
PP2Cc 108..390 CDD:238083 99/398 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.