DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and Ilkap

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_072128.2 Gene:Ilkap / 64538 RGDID:620128 Length:392 Species:Rattus norvegicus


Alignment Length:398 Identity:101/398 - (25%)
Similarity:144/398 - (36%) Gaps:160/398 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 GRRPRMEDRFIIEENINNN--------TGISFFAVFDGHGGEFAADFAKDVLVKNIYNK-----I 169
            |.|..|:|..:|..:|...        |.:|:|||||||||..|:.||...|.:|:..|     :
  Rat   116 GEREEMQDAHVILNDITQECNPPSSLITRVSYFAVFDGHGGIRASKFAAQNLHQNLIRKFPKGDV 180

  Fly   170 IEMSKLLKTEGNSGDYDKSPYLARKQSRKDANKENTEPTAGVMRKDSLRKAHSTTADCSAIKQKT 234
            |.:.|.:                 |:...|..|...|                     ..:||  
  Rat   181 ISVEKTV-----------------KRCLLDTFKHTDE---------------------EFLKQ-- 205

  Fly   235 TEASIADIYTVQLNSAMRASGNLGAAKDSFLNNNNNGQNGAANAPPPNYEAKCYIEHGRINFGKL 299
                              ||....|.||                                     
  Rat   206 ------------------ASSQKPAWKD------------------------------------- 215

  Fly   300 ITDEIMSADYKLVEQAKRATNIAGTTALIAIVQGSKLIVANVGDSRGVMYDW-----RGIAIPLS 359
                                   |:||...:...:.|.:||:||||.::..:     :..|:.||
  Rat   216 -----------------------GSTATCVLAVDNILYIANLGDSRAILCRYNEESQKHAALSLS 257

  Fly   360 FDHKPQQVRERKRIHDAGGFIAFRGVWRVAGVLATSRALGDYPLKDKNLVIATPDILTFEL--ND 422
            .:|.|.|..||.||..|||.:.   ..||.|||..||::||...| :..|.:.|||...:|  ||
  Rat   258 KEHNPTQYEERMRIQKAGGNVR---DGRVLGVLEVSRSIGDGQYK-RCGVTSVPDIRRCQLTPND 318

  Fly   423 HKPHFLILASDGLWDTFSNEEACTFALEHLKE---------PDFGAK------SLAMESYKRGSV 472
               .|::||.|||:..|:.|||..|.|..|::         |...|:      .||.::.:|||.
  Rat   319 ---RFILLACDGLFKVFTPEEAVNFILSCLEDEKIQTREGKPAVDARYEAACNRLANKAVQRGSA 380

  Fly   473 DNITVLVI 480
            ||:||:|:
  Rat   381 DNVTVMVV 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 101/398 (25%)
IlkapNP_072128.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..91
PP2Cc 108..390 CDD:238083 101/398 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.