DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and PPM1H

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_065751.1 Gene:PPM1H / 57460 HGNCID:18583 Length:514 Species:Homo sapiens


Alignment Length:475 Identity:112/475 - (23%)
Similarity:176/475 - (37%) Gaps:157/475 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 DHQSWEEMKQQSSAFAVLGRRPRMEDR----------FIIEENINNNTGIS--FFAVFDGHGGEF 152
            |..|.|.:..:..|.||.....|...:          ..::|| :.:.|:|  ::::||||.|..
Human    94 DQASCEVLTVKKKAGAVTSTPNRNSSKRRSSLPNGEGLQLKEN-SESEGVSCHYWSLFDGHAGSG 157

  Fly   153 AADFAKDVLVKNIYNKIIEMSKLLKTEGNSGDYDKSPYLARKQSRKDANKENTEPTAGVMRKDSL 217
            ||..|..:|..:|..::.::..:||                       |.....||         
Human   158 AAVVASRLLQHHITEQLQDIVDILK-----------------------NSAVLPPT--------- 190

  Fly   218 RKAHSTTADCSAIKQKTTEASIADIYTVQLNSAMRASGNLGAAKDSFLNNNNNGQNGAANAPPPN 282
                     |...:.:.|.|:     :..|..|....|.:||.             |:.:.||..
Human   191 ---------CLGEEPENTPAN-----SRTLTRAASLRGGVGAP-------------GSPSTPPTR 228

  Fly   283 YEAKCYIEHGRINFGKLITDEIMSADYKLVEQAKRATNIA-GTTALIAIVQGSKLIVANVGDSRG 346
            :..:..|.|..:..|.| .......|.: :|:.:.:.||: |.||||.|....||.|||.||||.
Human   229 FFTEKKIPHECLVIGAL-ESAFKEMDLQ-IERERSSYNISGGCTALIVICLLGKLYVANAGDSRA 291

  Fly   347 VMYDWRGIAIPLSFDHKPQQVRER----------------------KRIH--DAGGFIAFRGV-- 385
            ::.. .|..||:|.:..|:..|:|                      :|:.  :.|..:.:|..  
Human   292 IIIR-NGEIIPMSSEFTPETERQRLQYLAFMQPHLLGNEFTHLEFPRRVQRKELGKKMLYRDFNM 355

  Fly   386 --W----------------------RVAGVLATSRALGDYPLK--DKNLVI-----ATPDILTFE 419
              |                      ||...:..:|.|||:.||  |.|:.|     :.|::..::
Human   356 TGWAYKTIEDEDLKFPLIYGEGKKARVMATIGVTRGLGDHDLKVHDSNIYIKPFLSSAPEVRIYD 420

  Fly   420 LN--DH-KPHFLILASDGLWDTFSNEEACTFALEHLK--EPD------FGAKSLAMESY------ 467
            |:  || ....||||:|||||..||||......:.|.  :||      ..|:.|.|.:.      
Human   421 LSKYDHGSDDVLILATDGLWDVLSNEEVAEAITQFLPNCDPDDPHRYTLAAQDLVMRARGVLKDR 485

  Fly   468 -------KRGSVDNITVLVI 480
                   :.||.|:|:|.||
Human   486 GWRISNDRLGSGDDISVYVI 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 109/464 (23%)
PPM1HNP_065751.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 109..135 3/25 (12%)
PP2Cc 143..507 CDD:238083 102/425 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.