DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and ppm1nb

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001096587.1 Gene:ppm1nb / 564875 ZFINID:ZDB-GENE-071004-34 Length:435 Species:Danio rerio


Alignment Length:171 Identity:59/171 - (34%)
Similarity:87/171 - (50%) Gaps:17/171 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   323 GTTALIAIVQGSKLIVANVGDSRGVMYDWRGIAIPLSFDHKPQQVRERKRIHDAGGFIAFRGVWR 387
            |||.:...:....:...|.||||.|:.....:|.... ||||....|::||..|||.:..:   |
Zfish   177 GTTVVSTAITPHHIYFVNCGDSRAVLCRAGRVAFSTE-DHKPFSPGEKERIESAGGSVTLQ---R 237

  Fly   388 VAGVLATSRALGDYPLK-------DKNLVIATPDILTFELNDHKPHFLILASDGLWDTFSNEEAC 445
            |.|.||.||||||:..|       .:.:|...|::...| ......||:||.||:|||.||||.|
Zfish   238 VNGSLAVSRALGDFSYKTVEWRSVTEQMVSPEPEVSVVE-RSPADEFLVLACDGVWDTVSNEELC 301

  Fly   446 TFALEHLK----EPDFGAKSLAMESYKRGSVDNITVLVIVF 482
            .|....|:    ..:..::.:.:..|| ||:|||:::::.|
Zfish   302 AFVHSRLRICTDLREVCSQVIDLCLYK-GSLDNISIILVCF 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 58/169 (34%)
ppm1nbNP_001096587.1 PP2Cc 79..341 CDD:238083 58/169 (34%)
PP2C_C 335..412 CDD:285117 1/7 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.