DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and pdp1

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001104628.1 Gene:pdp1 / 558728 ZFINID:ZDB-GENE-060810-70 Length:519 Species:Danio rerio


Alignment Length:280 Identity:67/280 - (23%)
Similarity:99/280 - (35%) Gaps:103/280 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 DSFLNNNNNGQNGAANAP-------PPNYEAKCYIEHGRINFGKLIT--------------DEIM 305
            ::.:...|..:||....|       |.:|.:|   |..|:.|..|.|              .|:.
Zfish   158 ETLIELENAVENGRPLHPILQWHKHPNDYFSK---EASRLYFSSLRTYWQELLDLSVPGEQPEVA 219

  Fly   306 SADYKLVEQAKRATN-----------------------IAGTTALIAIVQGSKLIVANVGDSRGV 347
            .|   ||...||..|                       .:|.||.:|.:.|::|.|||.||.|.|
Zfish   220 EA---LVTAFKRLDNDISLEAQVGDPNAFLHYWVLRVAFSGATACVAHIDGNELHVANTGDGRAV 281

  Fly   348 MYDWRGI--------AIPLSFDHKPQQVRERKRI-----HDAGGFIAFRGVWRVAGVLATSRALG 399
            :    |:        |:.|:.||..|...|.:|:     |.....:..:.  |:.|:|...||.|
Zfish   282 L----GVQEPDGSFSALTLTNDHNAQNESEVQRVRSEHPHSEAKTVVKQD--RLLGLLMPFRAFG 340

  Fly   400 DYPLK-----DKNLVIATPDILTFELNDH---------------------------KPHFLILAS 432
            |...|     .:.::.:.||.|  ..|:|                           :..||:|.|
Zfish   341 DVKFKWSIELQRRVLESGPDQL--HENEHAKFIPPNYHTPPYLTAEPEVTRHRLRPQDRFLVLGS 403

  Fly   433 DGLWDTFSNEEACTFALEHL 452
            ||||:|...:|......|||
Zfish   404 DGLWETLHRQEVVRIVGEHL 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 67/280 (24%)
pdp1NP_001104628.1 PP2Cc 96..511 CDD:238083 67/280 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.