DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and ppm1f

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001018165.1 Gene:ppm1f / 553757 ZFINID:ZDB-GENE-051128-2 Length:424 Species:Danio rerio


Alignment Length:382 Identity:92/382 - (24%)
Similarity:142/382 - (37%) Gaps:135/382 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 SAFAVLGRRPRMEDRFIIEENIN------NNTGISFFAVFDGHGGEFAADFAKDVLVKNIYNKII 170
            |..|:...|.:||||.:|.:..|      :..|..::||||||||..||.::...|     :.::
Zfish   142 SVHAIRNTRRKMEDRHVILKEFNQLLGLQDGVGREYYAVFDGHGGVDAATYSATHL-----HIVL 201

  Fly   171 EMSKLLKTEGNSGDYDKSPYLARKQSRKDANKENTEPTAGVMRKDSLRKAHSTTADCSAIKQKTT 235
            .....|||:.                                              .:|.|...|
Zfish   202 SQQGELKTDA----------------------------------------------ATAFKNTFT 220

  Fly   236 EASIADIYTVQLNSAMRASGNLGAAKDSFLNNNNNGQNGAANAPPPNYEAKCYIEHGRINFGKLI 300
            :                                                                
Zfish   221 Q---------------------------------------------------------------- 221

  Fly   301 TDEIMSADYKLVEQAKRATNIAGTTALIAIVQGSKLIVANVGDSRGVMYDWRGIAIPLSFDHKPQ 365
            ||::    :|:  :|||....:|:|.:..::....|.|:.:|||:.::.. :|..:.|...|||:
Zfish   222 TDDM----FKI--KAKRERLRSGSTGVAVLLTSDLLTVSWLGDSQALLVR-QGEPVTLMDPHKPE 279

  Fly   366 QVRERKRIHDAGGFIAFRGVWRVAGVLATSRALGDYPLKDKNLVIATPDILTFELNDHKPHFLIL 430
            :..|:|||.|.||.|||.|.|||.|..|.|||:||:  ..|..|....|..:|.|...: .:::|
Zfish   280 REDEKKRIEDLGGCIAFMGCWRVNGTYAVSRAIGDF--DQKPYVSNEADSSSFHLTGDE-DYVLL 341

  Fly   431 ASDGLWDTFSNEEACTFALEHLKEPDFG----AKSLAMESYKRGSVDNITVLVIVFK 483
            |.||.:|.....:.....||.|:|....    |:||..::...||.||||||::..|
Zfish   342 ACDGFFDVIRPADVPALVLEALRESGGSGNDVAQSLVAQAKTAGSSDNITVLLVFLK 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 91/379 (24%)
ppm1fNP_001018165.1 PP2Cc 140..397 CDD:238083 91/379 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X119
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.