DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and ppm1kb

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001314673.1 Gene:ppm1kb / 503713 ZFINID:ZDB-GENE-050306-8 Length:372 Species:Danio rerio


Alignment Length:373 Identity:94/373 - (25%)
Similarity:149/373 - (39%) Gaps:134/373 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 LGRRPRMEDRFIIEENINNNTGISFFAVFDGHGGEFAADFAKDVLVKNIYNKIIEMSKLLKTEGN 181
            :|:|...|||:.:.:..:|   |.:|||||||||..||||.                        
Zfish   101 IGQRKENEDRYQMSQMTDN---IMYFAVFDGHGGAEAADFC------------------------ 138

  Fly   182 SGDYDKSPYLARKQSRKDANKENTEPTAGVMRKDSLRKAHSTTADCSAIKQKTTEASIADIYTVQ 246
                                                              .|..|..|.||    
Zfish   139 --------------------------------------------------HKNMEKHIKDI---- 149

  Fly   247 LNSAMRASGNLGAAKDSFLNNNNNGQNGAANAPPPNYE---AKCYIEHGRINFGKLITDEI-MSA 307
                        ||:::                  |.|   .|.::|     ..|.:...: .||
Zfish   150 ------------AAEET------------------NLEFVLTKAFLE-----VDKALARHLHFSA 179

  Fly   308 DYKLVEQAKRATNIAGTTALIAIVQ-GSKLIVANVGDSRGVMYDWRGIAIPLSFDHKPQQVRERK 371
            |..::.        |||||.:|::: |.:|:|.:|||||.:|.. :|.|:.|:.||.|::..|::
Zfish   180 DASVLS--------AGTTATVALLRDGIELVVGSVGDSRAMMCR-KGKAVKLTVDHTPERKDEKE 235

  Fly   372 RIHDAGGFIAFR--GVWRVAGVLATSRALGDYPLKDKNLVIATPDILTFELNDHKPHFLILASDG 434
            ||..:||||.:.  |...|.|.||.:|::||:.||... |||.|:.....|:.....||.|.:||
Zfish   236 RIRRSGGFITWNSLGQPHVNGRLAMTRSIGDFDLKATG-VIAEPETKRISLHHVHDSFLALTTDG 299

  Fly   435 LWDTFSNEEACTFALEHLKEPDFGAKSLAMESYKRGSVDNITVLVIVF 482
            :....:::|.|. .:....:|...|:.::.::.:.||.||.|::|:.|
Zfish   300 INFIMNSQEICD-VINQCHDPKEAAQRISEQALQYGSEDNSTIIVVPF 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 93/371 (25%)
ppm1kbNP_001314673.1 PP2Cc 94..346 CDD:238083 93/371 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X119
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.