DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and pptc7a

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001007379.1 Gene:pptc7a / 492506 ZFINID:ZDB-GENE-041114-74 Length:297 Species:Danio rerio


Alignment Length:219 Identity:44/219 - (20%)
Similarity:75/219 - (34%) Gaps:90/219 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   309 YKLVEQAKRATNIAGTTALIAIV--QGSKLIVANVGDSRGVMYDWRGIAIPLSFDHKPQQVRERK 371
            |:|::  .:...:..:||.|.::  |..:|..||:|||                           
Zfish   117 YELLQ--NKVPLLGSSTACIVVLDRQSHRLHTANLGDS--------------------------- 152

  Fly   372 RIHDAGGFIAFRGVWRVAGVLATSRALGDYPLKDKNLVIATPDILTFELNDHKP----------- 425
                  ||:..||    ..|:..|.....|......|.||.|:.....|:|...           
Zfish   153 ------GFLVVRG----GEVVHRSDEQQHYFNTPFQLSIAPPEAEGSVLSDSPDAADSSSFDVQL 207

  Fly   426 -HFLILASDGLWDTFSN----EEACTFALEHLKEPDF-----GAKSLAMESY------------- 467
             ..::.|:|||:|...:    :|     |:.||..::     .|||:|.:::             
Zfish   208 GDIILTATDGLFDNMPDYMILQE-----LKKLKNTNYESTQQTAKSIAEQAHVLAYDPNYMSPFA 267

  Fly   468 ----------KRGSVDNITVLVIV 481
                      :.|..|:||||:.:
Zfish   268 QFACDNGLNVRGGKPDDITVLLSI 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 44/219 (20%)
pptc7aNP_001007379.1 PP2Cc 53..289 CDD:381813 43/215 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.