Sequence 1: | NP_001260216.1 | Gene: | CG7115 / 34069 | FlyBaseID: | FBgn0027515 | Length: | 524 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001007379.1 | Gene: | pptc7a / 492506 | ZFINID: | ZDB-GENE-041114-74 | Length: | 297 | Species: | Danio rerio |
Alignment Length: | 219 | Identity: | 44/219 - (20%) |
---|---|---|---|
Similarity: | 75/219 - (34%) | Gaps: | 90/219 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 309 YKLVEQAKRATNIAGTTALIAIV--QGSKLIVANVGDSRGVMYDWRGIAIPLSFDHKPQQVRERK 371
Fly 372 RIHDAGGFIAFRGVWRVAGVLATSRALGDYPLKDKNLVIATPDILTFELNDHKP----------- 425
Fly 426 -HFLILASDGLWDTFSN----EEACTFALEHLKEPDF-----GAKSLAMESY------------- 467
Fly 468 ----------KRGSVDNITVLVIV 481 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7115 | NP_001260216.1 | PP2Cc | 111..482 | CDD:238083 | 44/219 (20%) |
pptc7a | NP_001007379.1 | PP2Cc | 53..289 | CDD:381813 | 43/215 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0631 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |